tests: Add alpha13 dumped provision
authorMatthieu Patou <mat@matws.net>
Wed, 8 Jun 2011 21:01:25 +0000 (01:01 +0400)
committerAndrew Tridgell <tridge@samba.org>
Thu, 21 Jul 2011 01:44:35 +0000 (11:44 +1000)
23 files changed:
source4/selftest/provisions/alpha13/etc/smb.conf.template [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/dns.keytab [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/dns/alpha13.samba.corp.zone [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/dns_update_list [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/eadb.tdb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/hklm.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/idmap.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/krb5.conf [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/named.conf [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/named.conf.update [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/named.txt [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/phpldapadmin-config.php [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/privilege.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/sam.ldb.d/CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/sam.ldb.d/CN=SCHEMA,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/sam.ldb.d/DC=ALPHA13,DC=SAMBA,DC=CORP.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/sam.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/secrets.keytab [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/secrets.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/share.ldb.dump [new file with mode: 0644]
source4/selftest/provisions/alpha13/private/spn_update_list [new file with mode: 0644]
source4/selftest/provisions/alpha13/sysvol/alpha13.samba.corp/Policies/{31B2F340-016D-11D2-945F-00C04FB984F9}/GPT.INI [new file with mode: 0644]
source4/selftest/provisions/alpha13/sysvol/alpha13.samba.corp/Policies/{6AC1786C-016F-11D2-945F-00C04FB984F9}/GPT.INI [new file with mode: 0644]

diff --git a/source4/selftest/provisions/alpha13/etc/smb.conf.template b/source4/selftest/provisions/alpha13/etc/smb.conf.template
new file mode 100644 (file)
index 0000000..cc6c82f
--- /dev/null
@@ -0,0 +1,17 @@
+[globals]
+       netbios name    = ARES
+       workgroup       = SAMBA
+       realm           = ALPHA13.SAMBA.CORP
+       server role     = domain controller
+
+       private dir = @@PREFIX@@/alpha13/private
+       lock dir = @@PREFIX@@/alpha13
+       posix:eadb = @@PREFIX@@/alpha13/private/eadb.tdb
+
+[netlogon]
+       path = @@PREFIX@@/alpha13/sysvol/alpha13.samba.corp/scripts
+       read only = no
+
+[sysvol]
+       path = @@PREFIX@@/alpha13/sysvol
+       read only = no
diff --git a/source4/selftest/provisions/alpha13/private/dns.keytab b/source4/selftest/provisions/alpha13/private/dns.keytab
new file mode 100644 (file)
index 0000000..11d6b03
Binary files /dev/null and b/source4/selftest/provisions/alpha13/private/dns.keytab differ
diff --git a/source4/selftest/provisions/alpha13/private/dns/alpha13.samba.corp.zone b/source4/selftest/provisions/alpha13/private/dns/alpha13.samba.corp.zone
new file mode 100644 (file)
index 0000000..0a88854
--- /dev/null
@@ -0,0 +1,50 @@
+; -*- zone -*-
+; generated by provision.pl
+$ORIGIN alpha13.samba.corp.
+$TTL 1W
+@               IN SOA  @   hostmaster (
+                                2011060821   ; serial
+                                2D              ; refresh
+                                4H              ; retry
+                                6W              ; expiry
+                                1W )            ; minimum
+                       IN NS   ares
+
+            IN A    172.16.100.1
+;
+
+ares        IN A    172.16.100.1
+gc._msdcs               IN A    172.16.100.1
+
+ae2e14df-3484-49bb-b8b2-7611e5abf877._msdcs    IN CNAME        ares
+;
+; global catalog servers
+_gc._tcp               IN SRV 0 100 3268       ares
+_gc._tcp.Default-First-Site-Name._sites        IN SRV 0 100 3268       ares
+_ldap._tcp.gc._msdcs   IN SRV 0 100 3268       ares
+_ldap._tcp.Default-First-Site-Name._sites.gc._msdcs    IN SRV 0 100 3268 ares
+;
+; ldap servers
+_ldap._tcp             IN SRV 0 100 389        ares
+_ldap._tcp.dc._msdcs   IN SRV 0 100 389        ares
+_ldap._tcp.pdc._msdcs  IN SRV 0 100 389        ares
+_ldap._tcp.e995e189-6b16-44a3-b897-0e46f67276dc.domains._msdcs         IN SRV 0 100 389 ares
+_ldap._tcp.Default-First-Site-Name._sites              IN SRV 0 100 389 ares
+_ldap._tcp.Default-First-Site-Name._sites.dc._msdcs    IN SRV 0 100 389 ares
+;
+; krb5 servers
+_kerberos._tcp         IN SRV 0 100 88         ares
+_kerberos._tcp.dc._msdcs       IN SRV 0 100 88 ares
+_kerberos._tcp.Default-First-Site-Name._sites  IN SRV 0 100 88 ares
+_kerberos._tcp.Default-First-Site-Name._sites.dc._msdcs        IN SRV 0 100 88 ares
+_kerberos._udp         IN SRV 0 100 88         ares
+; MIT kpasswd likes to lookup this name on password change
+_kerberos-master._tcp          IN SRV 0 100 88         ares
+_kerberos-master._udp          IN SRV 0 100 88         ares
+;
+; kpasswd
+_kpasswd._tcp          IN SRV 0 100 464        ares
+_kpasswd._udp          IN SRV 0 100 464        ares
+;
+; heimdal 'find realm for host' hack
+_kerberos              IN TXT  ALPHA13.SAMBA.CORP
diff --git a/source4/selftest/provisions/alpha13/private/dns_update_list b/source4/selftest/provisions/alpha13/private/dns_update_list
new file mode 100644 (file)
index 0000000..c69e155
--- /dev/null
@@ -0,0 +1,22 @@
+# this is a list of DNS entries which will be put into DNS using
+# dynamic DNS update. It is processed by the samba_dnsupdate script
+A                                                        ${DNSDOMAIN} $IP
+A                                                        ${HOSTNAME} $IP
+CNAME ${NTDSGUID}._msdcs.${DNSDOMAIN}                    ${HOSTNAME}
+SRV _kerberos._tcp.${SITE}._sites.dc._msdcs.${DNSDOMAIN} ${HOSTNAME} 88
+SRV _ldap._tcp.${SITE}._sites.dc._msdcs.${DNSDOMAIN}     ${HOSTNAME} 389
+SRV _kerberos._tcp.dc._msdcs.${DNSDOMAIN}                ${HOSTNAME} 88
+SRV _ldap._tcp.dc._msdcs.${DNSDOMAIN}                    ${HOSTNAME} 389
+SRV _ldap._tcp.${DOMAINGUID}.domains._msdcs.${DNSDOMAIN} ${HOSTNAME} 389
+SRV _ldap._tcp.${SITE}._sites.gc._msdcs.${DNSDOMAIN}     ${HOSTNAME} 3268
+SRV _ldap._tcp.gc._msdcs.${DNSDOMAIN}                    ${HOSTNAME} 3268
+SRV _ldap._tcp.pdc._msdcs.${DNSDOMAIN}                   ${HOSTNAME} 389
+SRV _gc._tcp.${SITE}._sites.${DNSDOMAIN}                 ${HOSTNAME} 3268
+SRV _kerberos._tcp.${SITE}._sites.${DNSDOMAIN}           ${HOSTNAME} 88
+SRV _ldap._tcp.${SITE}._sites.${DNSDOMAIN}              ${HOSTNAME} 389
+SRV _gc._tcp.${DNSDOMAIN}                                ${HOSTNAME} 3268
+SRV _kerberos._tcp.${DNSDOMAIN}                          ${HOSTNAME} 88
+SRV _kpasswd._tcp.${DNSDOMAIN}                           ${HOSTNAME} 464
+SRV _ldap._tcp.${DNSDOMAIN}                              ${HOSTNAME} 389
+SRV _kerberos._udp.${DNSDOMAIN}                          ${HOSTNAME} 88
+SRV _kpasswd._udp.${DNSDOMAIN}                           ${HOSTNAME} 464
diff --git a/source4/selftest/provisions/alpha13/private/eadb.tdb.dump b/source4/selftest/provisions/alpha13/private/eadb.tdb.dump
new file mode 100644 (file)
index 0000000..cfd6a0d
--- /dev/null
@@ -0,0 +1,96 @@
+{
+key(27) = "\16\00\00\00\00\00\00\00w\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00y\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00p\05\0E\00\00\00\00\00security.NTACL"
+data(168) = "\01\00\01\00\00\00\02\00\01\00\04\90\1C\00\00\008\00\00\00\00\00\00\00H\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\F4\01\00\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\04\00`\00\04\00\00\00\00\03\18\00\FF\01\1F\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\00\03\18\00\A9\00\12\00\01\02\00\00\00\00\00\05 \00\00\00%\02\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00z\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00r\05\0E\00\00\00\00\00security.NTACL"
+data(168) = "\01\00\01\00\00\00\02\00\01\00\04\90\1C\00\00\008\00\00\00\00\00\00\00H\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\F4\01\00\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\04\00`\00\04\00\00\00\00\03\18\00\FF\01\1F\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\00\03\18\00\A9\00\12\00\01\02\00\00\00\00\00\05 \00\00\00%\02\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00t\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00v\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00x\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00w\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00y\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00q\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00{\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00q\05\0E\00\00\00\00\00security.NTACL"
+data(168) = "\01\00\01\00\00\00\02\00\01\00\04\90\1C\00\00\008\00\00\00\00\00\00\00H\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\F4\01\00\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\04\00`\00\04\00\00\00\00\03\18\00\FF\01\1F\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\00\03\18\00\A9\00\12\00\01\02\00\00\00\00\00\05 \00\00\00%\02\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00{\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00s\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00u\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00t\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00v\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00x\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00p\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00z\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(27) = "\16\00\00\00\00\00\00\00r\05\0E\00\00\00\00\00.xattr_list"
+data(15) = "security.NTACL\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00s\05\0E\00\00\00\00\00security.NTACL"
+data(204) = "\01\00\01\00\00\00\02\00\01\00\04\90\1C\00\00\008\00\00\00\00\00\00\00H\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\F4\01\00\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\04\00\84\00\05\00\00\00\00\03\18\00\FF\01\1F\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\00\03\18\00\A9\00\12\00\01\02\00\00\00\00\00\05 \00\00\00%\02\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03$\00\BF\01\13\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\08\02\00\00"
+}
+{
+key(30) = "\16\00\00\00\00\00\00\00u\05\0E\00\00\00\00\00security.NTACL"
+data(400) = "\01\00\01\00\00\00\02\00\01\00\14\98\1C\00\00\008\00\00\00T\00\00\00\CC\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00x\00\02\00\00\00\07R8\00 \00\00\00\03\00\00\00\BE;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\07R8\00 \00\00\00\03\00\00\00\BF;\0E\F3\F0\9F\D1\11\B6\03\00\00\F8\03g\C1\A5z\96\BF\E6\0D\D0\11\A2\85\00\AA\000I\E2\01\01\00\00\00\00\00\01\00\00\00\00\04\00\C4\00\07\00\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\03$\00\FF\01\1F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\0B\14\00\FF\01\1F\00\01\01\00\00\00\00\00\03\00\00\00\00\00\03\14\00\FF\01\1F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\03\14\00\A9\00\12\00\01\01\00\00\00\00\00\05\09\00\00\00"
+}
diff --git a/source4/selftest/provisions/alpha13/private/hklm.ldb.dump b/source4/selftest/provisions/alpha13/private/hklm.ldb.dump
new file mode 100644 (file)
index 0000000..16b2c40
--- /dev/null
@@ -0,0 +1,80 @@
+{
+key(78) = "DN=KEY=TERMINAL SERVER,KEY=CONTROL,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(111) = "g\19\01&\01\00\00\00key=Terminal Server,key=Control,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\0F\00\00\00Terminal Server\00"
+}
+{
+key(86) = "DN=KEY=PARAMETERS,KEY=ALERTER,KEY=SERVICES,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(114) = "g\19\01&\01\00\00\00key=Parameters,key=Alerter,key=Services,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\0A\00\00\00Parameters\00"
+}
+{
+key(87) = "DN=KEY=PARAMETERS,KEY=NETLOGON,KEY=SERVICES,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(115) = "g\19\01&\01\00\00\00key=Parameters,key=Netlogon,key=Services,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\0A\00\00\00Parameters\00"
+}
+{
+key(40) = "DN=KEY=MICROSOFT,KEY=SOFTWARE,HIVE=NONE\00"
+data(67) = "g\19\01&\01\00\00\00key=Microsoft,key=SOFTWARE,hive=NONE\00key\00\01\00\00\00\09\00\00\00Microsoft\00"
+}
+{
+key(74) = "DN=KEY=CURRENTVERSION,KEY=WINDOWS NT,KEY=MICROSOFT,KEY=SOFTWARE,HIVE=NONE\00"
+data(106) = "g\19\01&\01\00\00\00key=CurrentVersion,key=Windows NT,key=Microsoft,key=SOFTWARE,hive=NONE\00key\00\01\00\00\00\0E\00\00\00CurrentVersion\00"
+}
+{
+key(68) = "DN=KEY=PRINT,KEY=CONTROL,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(91) = "g\19\01&\01\00\00\00key=Print,key=Control,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\05\00\00\00Print\00"
+}
+{
+key(59) = "DN=KEY=SERVICES,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(85) = "g\19\01&\01\00\00\00key=Services,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\08\00\00\00Services\00"
+}
+{
+key(15) = "DN=@ATTRIBUTES\00"
+data(80) = "g\19\01&\02\00\00\00@ATTRIBUTES\00key\00\01\00\00\00\10\00\00\00CASE_INSENSITIVE\00value\00\01\00\00\00\10\00\00\00CASE_INSENSITIVE\00"
+}
+{
+key(46) = "DN=KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(81) = "g\19\01&\01\00\00\00key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\11\00\00\00CurrentControlSet\00"
+}
+{
+key(77) = "DN=KEY=PRODUCTOPTIONS,KEY=CONTROL,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(109) = "g\19\01&\01\00\00\00key=ProductOptions,key=Control,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\0E\00\00\00ProductOptions\00"
+}
+{
+key(71) = "DN=KEY=ALERTER,KEY=SERVICES,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(96) = "g\19\01&\01\00\00\00key=Alerter,key=Services,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\07\00\00\00Alerter\00"
+}
+{
+key(114) = "DN=VALUE=REFUSEPASSWORDCHANGE,KEY=PARAMETERS,KEY=NETLOGON,KEY=SERVICES,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(193) = "g\19\01&\03\00\00\00value=RefusePasswordChange,key=Parameters,key=Netlogon,key=Services,key=CurrentControlSet,key=SYSTEM,hive=NONE\00data\00\01\00\00\00\0A\00\00\000x00000000\00type\00\01\00\00\00\01\00\00\004\00value\00\01\00\00\00\14\00\00\00RefusePasswordChange\00"
+}
+{
+key(95) = "DN=VALUE=PRODUCTTYPE,KEY=PRODUCTOPTIONS,KEY=CONTROL,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(164) = "g\19\01&\03\00\00\00value=ProductType,key=ProductOptions,key=Control,key=CurrentControlSet,key=SYSTEM,hive=NONE\00data\00\01\00\00\00\09\00\00\00LanmanNT\00\00type\00\01\00\00\00\01\00\00\001\00value\00\01\00\00\00\0B\00\00\00ProductType\00"
+}
+{
+key(55) = "DN=KEY=WINDOWS NT,KEY=MICROSOFT,KEY=SOFTWARE,HIVE=NONE\00"
+data(83) = "g\19\01&\01\00\00\00key=Windows NT,key=Microsoft,key=SOFTWARE,hive=NONE\00key\00\01\00\00\00\0A\00\00\00Windows NT\00"
+}
+{
+key(13) = "DN=@BASEINFO\00"
+data(82) = "g\19\01&\02\00\00\00@BASEINFO\00whenChanged\00\01\00\00\00\11\00\00\0020110608171909.0Z\00sequenceNumber\00\01\00\00\00\02\00\00\0023\00"
+}
+{
+key(58) = "DN=KEY=CONTROL,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(83) = "g\19\01&\01\00\00\00key=Control,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\07\00\00\00Control\00"
+}
+{
+key(95) = "DN=VALUE=CURRENTVERSION,KEY=CURRENTVERSION,KEY=WINDOWS NT,KEY=MICROSOFT,KEY=SOFTWARE,HIVE=NONE\00"
+data(162) = "g\19\01&\03\00\00\00value=CurrentVersion,key=CurrentVersion,key=Windows NT,key=Microsoft,key=SOFTWARE,hive=NONE\00data\00\01\00\00\00\04\00\00\006.1\00\00type\00\01\00\00\00\01\00\00\001\00value\00\01\00\00\00\0E\00\00\00CurrentVersion\00"
+}
+{
+key(72) = "DN=KEY=NETLOGON,KEY=SERVICES,KEY=CURRENTCONTROLSET,KEY=SYSTEM,HIVE=NONE\00"
+data(98) = "g\19\01&\01\00\00\00key=Netlogon,key=Services,key=CurrentControlSet,key=SYSTEM,hive=NONE\00key\00\01\00\00\00\08\00\00\00Netlogon\00"
+}
+{
+key(24) = "DN=KEY=SYSTEM,HIVE=NONE\00"
+data(48) = "g\19\01&\01\00\00\00key=SYSTEM,hive=NONE\00key\00\01\00\00\00\06\00\00\00SYSTEM\00"
+}
+{
+key(26) = "DN=KEY=SOFTWARE,HIVE=NONE\00"
+data(52) = "g\19\01&\01\00\00\00key=SOFTWARE,hive=NONE\00key\00\01\00\00\00\08\00\00\00SOFTWARE\00"
+}
diff --git a/source4/selftest/provisions/alpha13/private/idmap.ldb.dump b/source4/selftest/provisions/alpha13/private/idmap.ldb.dump
new file mode 100644 (file)
index 0000000..7c0bc19
--- /dev/null
@@ -0,0 +1,60 @@
+{
+key(62) = "DN=@INDEX:OBJECTSID::AQUAAAAAAAUVAAAAA881wVCWcmLT/WztAQIAAA==\00"
+data(151) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQUAAAAAAAUVAAAAA881wVCWcmLT/WztAQIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\000\00\00\00CN=S-1-5-21-3241529091-1651676752-3983343059-513\00"
+}
+{
+key(22) = "DN=@INDEX:XIDNUMBER:0\00"
+data(111) = "g\19\01&\02\00\00\00@INDEX:XIDNUMBER:0\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\000\00\00\00CN=S-1-5-21-3241529091-1651676752-3983343059-500\00"
+}
+{
+key(13) = "DN=CN=CONFIG\00"
+data(90) = "g\19\01&\03\00\00\00CN=CONFIG\00cn\00\01\00\00\00\06\00\00\00CONFIG\00lowerBound\00\01\00\00\00\07\00\00\003000000\00upperBound\00\01\00\00\00\07\00\00\004000000\00"
+}
+{
+key(26) = "DN=@INDEX:XIDNUMBER:65534\00"
+data(77) = "g\19\01&\02\00\00\00@INDEX:XIDNUMBER:65534\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\0A\00\00\00CN=S-1-5-7\00"
+}
+{
+key(14) = "DN=CN=S-1-5-7\00"
+data(145) = "g\19\01&\05\00\00\00CN=S-1-5-7\00cn\00\01\00\00\00\07\00\00\00S-1-5-7\00objectClass\00\01\00\00\00\06\00\00\00sidMap\00objectSid\00\01\00\00\00\0C\00\00\00\01\01\00\00\00\00\00\05\07\00\00\00\00type\00\01\00\00\00\0B\00\00\00ID_TYPE_UID\00xidNumber\00\01\00\00\00\05\00\00\0065534\00"
+}
+{
+key(62) = "DN=@INDEX:OBJECTSID::AQUAAAAAAAUVAAAAA881wVCWcmLT/Wzt9AEAAA==\00"
+data(151) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQUAAAAAAAUVAAAAA881wVCWcmLT/Wzt9AEAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\000\00\00\00CN=S-1-5-21-3241529091-1651676752-3983343059-500\00"
+}
+{
+key(24) = "DN=@INDEX:XIDNUMBER:100\00"
+data(113) = "g\19\01&\02\00\00\00@INDEX:XIDNUMBER:100\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\000\00\00\00CN=S-1-5-21-3241529091-1651676752-3983343059-513\00"
+}
+{
+key(46) = "DN=@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAIAIAAA==\00"
+data(102) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAIAIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\0F\00\00\00CN=S-1-5-32-544\00"
+}
+{
+key(13) = "DN=@BASEINFO\00"
+data(81) = "g\19\01&\02\00\00\00@BASEINFO\00whenChanged\00\01\00\00\00\11\00\00\0020110608171917.0Z\00sequenceNumber\00\01\00\00\00\01\00\00\007\00"
+}
+{
+key(52) = "DN=CN=S-1-5-21-3241529091-1651676752-3983343059-500\00"
+data(233) = "g\19\01&\05\00\00\00CN=S-1-5-21-3241529091-1651676752-3983343059-500\00cn\00\01\00\00\00-\00\00\00S-1-5-21-3241529091-1651676752-3983343059-500\00objectClass\00\01\00\00\00\06\00\00\00sidMap\00objectSid\00\01\00\00\00\1C\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\F4\01\00\00\00type\00\01\00\00\00\0B\00\00\00ID_TYPE_UID\00xidNumber\00\01\00\00\00\01\00\00\000\00"
+}
+{
+key(19) = "DN=CN=S-1-5-32-544\00"
+data(155) = "g\19\01&\05\00\00\00CN=S-1-5-32-544\00cn\00\01\00\00\00\0C\00\00\00S-1-5-32-544\00objectClass\00\01\00\00\00\06\00\00\00sidMap\00objectSid\00\01\00\00\00\10\00\00\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\00type\00\01\00\00\00\0B\00\00\00ID_TYPE_GID\00xidNumber\00\01\00\00\00\01\00\00\004\00"
+}
+{
+key(38) = "DN=@INDEX:OBJECTSID::AQEAAAAAAAUHAAAA\00"
+data(89) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQEAAAAAAAUHAAAA\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\0A\00\00\00CN=S-1-5-7\00"
+}
+{
+key(52) = "DN=CN=S-1-5-21-3241529091-1651676752-3983343059-513\00"
+data(235) = "g\19\01&\05\00\00\00CN=S-1-5-21-3241529091-1651676752-3983343059-513\00cn\00\01\00\00\00-\00\00\00S-1-5-21-3241529091-1651676752-3983343059-513\00objectClass\00\01\00\00\00\06\00\00\00sidMap\00objectSid\00\01\00\00\00\1C\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\00type\00\01\00\00\00\0B\00\00\00ID_TYPE_GID\00xidNumber\00\01\00\00\00\03\00\00\00100\00"
+}
+{
+key(22) = "DN=@INDEX:XIDNUMBER:4\00"
+data(78) = "g\19\01&\02\00\00\00@INDEX:XIDNUMBER:4\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\0F\00\00\00CN=S-1-5-32-544\00"
+}
+{
+key(14) = "DN=@INDEXLIST\00"
+data(60) = "g\19\01&\01\00\00\00@INDEXLIST\00@IDXATTR\00\02\00\00\00\09\00\00\00xidNumber\00\09\00\00\00objectSid\00"
+}
diff --git a/source4/selftest/provisions/alpha13/private/krb5.conf b/source4/selftest/provisions/alpha13/private/krb5.conf
new file mode 100644 (file)
index 0000000..e40f218
--- /dev/null
@@ -0,0 +1,17 @@
+[libdefaults]
+       default_realm = ALPHA13.SAMBA.CORP
+       dns_lookup_realm = true
+       dns_lookup_kdc = true
+       ticket_lifetime = 24h
+       forwardable = yes
+
+[realms]
+       ALPHA13.SAMBA.CORP = {
+               kdc = ares.alpha13.samba.corp:88
+               admin_server = ares.alpha13.samba.corp:749
+               default_domain = alpha13.samba.corp
+       }
+
+[domain_realm]
+       .alpha13.samba.corp = ALPHA13.SAMBA.CORP
+       alpha13.samba.corp = ALPHA13.SAMBA.CORP
diff --git a/source4/selftest/provisions/alpha13/private/named.conf b/source4/selftest/provisions/alpha13/private/named.conf
new file mode 100644 (file)
index 0000000..4d41024
--- /dev/null
@@ -0,0 +1,38 @@
+# This file should be included in your main BIND configuration file
+#
+# For example with
+# include "/home/mat/workspace/samba/alpha13/private/named.conf";
+
+zone "alpha13.samba.corp." IN {
+       type master;
+       file "/home/mat/workspace/samba/alpha13/private/dns/alpha13.samba.corp.zone";
+       /*
+        * the list of principals and what they can change is created
+        * dynamically by Samba, based on the membership of the domain controllers
+        * group. The provision just creates this file as an empty file.
+        */
+       include "/home/mat/workspace/samba/alpha13/private/named.conf.update";
+
+       /* we need to use check-names ignore so _msdcs A records can be created */
+       check-names ignore;
+};
+
+# The reverse zone configuration is optional.  The following example assumes a
+# subnet of 192.168.123.0/24:
+
+/*
+zone "123.168.192.in-addr.arpa" in {
+       type master;
+       file "123.168.192.in-addr.arpa.zone";
+       update-policy {
+               grant *.SAMBA.CORP wildcard *.123.168.192.in-addr.arpa. PTR;
+       };
+};
+*/
+
+# Note that the reverse zone file is not created during the provision process.
+
+# The most recent BIND versions (9.5.0a5 or later) support secure GSS-TSIG
+# updates.  If you are running an earlier version of BIND, or if you do not wish
+# to use secure GSS-TSIG updates, you may remove the update-policy sections in
+# both examples above.
diff --git a/source4/selftest/provisions/alpha13/private/named.conf.update b/source4/selftest/provisions/alpha13/private/named.conf.update
new file mode 100644 (file)
index 0000000..13cb29e
--- /dev/null
@@ -0,0 +1,4 @@
+/*
+       this file will be automatically replaced with the correct
+       'grant' rules by samba at runtime
+*/
diff --git a/source4/selftest/provisions/alpha13/private/named.txt b/source4/selftest/provisions/alpha13/private/named.txt
new file mode 100644 (file)
index 0000000..e444147
--- /dev/null
@@ -0,0 +1,46 @@
+# Additional informations for DNS setup using BIND
+
+# If you are running a capable version of BIND and you wish to support secure
+# GSS-TSIG updates, you must make the following configuration changes:
+
+# - Insert the following lines into the options {} section of your named.conf
+# file:
+tkey-gssapi-credential "DNS/alpha13.samba.corp";
+tkey-domain "ALPHA13.SAMBA.CORP";
+
+# - Modify BIND init scripts to pass the location of the generated keytab file.
+# Fedora 8 & later provide a variable named KEYTAB_FILE in /etc/sysconfig/named
+# for this purpose:
+KEYTAB_FILE="/home/mat/workspace/samba/alpha13/private/dns.keytab"
+# Note that the Fedora scripts translate KEYTAB_FILE behind the scenes into a
+# variable named KRB5_KTNAME, which is ultimately passed to the BIND daemon.  If
+# your distribution does not provide a variable like KEYTAB_FILE to pass a
+# keytab file to the BIND daemon, a workaround is to place the following line in
+# BIND's sysconfig file or in the init script for BIND:
+export KRB5_KTNAME="/home/mat/workspace/samba/alpha13/private/dns.keytab"
+
+# - Set appropriate ownership and permissions on the dns.keytab file.  Note
+# that most distributions have BIND configured to run under a non-root user
+# account.  For example, Fedora 9 runs BIND as the user "named" once the daemon
+# relinquishes its rights.  Therefore, the file dns.keytab must be readable
+# by the user that BIND run as.  If BIND is running as a non-root user, the
+# "dns.keytab" file must have its permissions altered to allow the daemon to
+# read it.  Under Fedora 9, execute the following commands:
+chgrp named /home/mat/workspace/samba/alpha13/private/dns.keytab
+chmod g+r /home/mat/workspace/samba/alpha13/private/dns.keytab
+
+# - Ensure the BIND zone file(s) that will be dynamically updated are in a
+# directory where the BIND daemon can write.  When BIND performs dynamic
+# updates, it not only needs to update the zone file itself but it must also
+# create a journal (.jnl) file to track the dynamic updates as they occur.
+# Under Fedora 9, the /var/named directory can not be written to by the "named"
+# user.  However, the directory /var/named/dynamic directory does provide write
+# access.  Therefore the zone files were placed under the /var/named/dynamic
+# directory.  The file directives in both example zone statements at the
+# beginning of this file were changed by prepending the directory "dynamic/".
+
+# - If SELinux is enabled, ensure that all files have the appropriate SELinux
+# file contexts.  The dns.keytab file must be accessible by the BIND daemon
+# and should have a SELinux type of named_conf_t.  This can be set with the
+# following command:
+chcon -t named_conf_t /home/mat/workspace/samba/alpha13/private/dns.keytab
diff --git a/source4/selftest/provisions/alpha13/private/phpldapadmin-config.php b/source4/selftest/provisions/alpha13/private/phpldapadmin-config.php
new file mode 100644 (file)
index 0000000..6c78c6a
--- /dev/null
@@ -0,0 +1,28 @@
+<?php
+/**
+ * The phpLDAPadmin config file, customised for use with Samba4
+ * This overrides phpLDAPadmin defaults
+ * that are defined in config_default.php.
+ *
+ * DONT change config_default.php, you changes will be lost by the next release
+ * of PLA. Instead change this file - as it will NOT be replaced by a new
+ * version of phpLDAPadmin.
+ */
+
+/*********************************************/
+/* Useful important configuration overrides  */
+/*********************************************/
+
+/* phpLDAPadmin can encrypt the content of sensitive cookies if you set this
+   to a big random string. */
+
+$i=0;
+$ldapservers = new LDAPServers;
+
+/* A convenient name that will appear in the tree viewer and throughout
+   phpLDAPadmin to identify this LDAP server to users. */
+$ldapservers->SetValue($i,'server','name','Samba4 LDAP Server');
+$ldapservers->SetValue($i,'server','host','ldapi://%2Fhome%2Fmat%2Fworkspace%2Fsamba%2Falpha13%2Fprivate%2Fldapi');
+$ldapservers->SetValue($i,'server','auth_type','session');
+$ldapservers->SetValue($i,'login','attr','dn');
+?>
diff --git a/source4/selftest/provisions/alpha13/private/privilege.ldb.dump b/source4/selftest/provisions/alpha13/private/privilege.ldb.dump
new file mode 100644 (file)
index 0000000..ea887ca
--- /dev/null
@@ -0,0 +1,156 @@
+{
+key(40) = "DN=@INDEX:PRIVILEGE:SESECURITYPRIVILEGE\00"
+data(97) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SESECURITYPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(45) = "DN=@INDEX:PRIVILEGE:SESYSTEMPROFILEPRIVILEGE\00"
+data(102) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SESYSTEMPROFILEPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(46) = "DN=@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJQIAAA==\00"
+data(103) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJQIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-549\00"
+}
+{
+key(20) = "DN=SID=S-1-5-32-550\00"
+data(214) = "g\19\01&\04\00\00\00sid=S-1-5-32-550\00comment\00\01\00\00\00\0F\00\00\00Print Operators\00objectClass\00\01\00\00\00\09\00\00\00privilege\00objectSid\00\01\00\00\00\10\00\00\00\01\02\00\00\00\00\00\05 \00\00\00&\02\00\00\00privilege\00\03\00\00\00\15\00\00\00SeLoadDriverPrivilege\00\13\00\00\00SeShutdownPrivilege\00\17\00\00\00SeInteractiveLogonRight\00"
+}
+{
+key(46) = "DN=@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAKgIAAA==\00"
+data(103) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAKgIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-554\00"
+}
+{
+key(44) = "DN=@INDEX:PRIVILEGE:SECHANGENOTIFYPRIVILEGE\00"
+data(122) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SECHANGENOTIFYPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\02\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-554\00"
+}
+{
+key(38) = "DN=@INDEX:PRIVILEGE:SEUNDOCKPRIVILEGE\00"
+data(95) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEUNDOCKPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(40) = "DN=@INDEX:PRIVILEGE:SENETWORKLOGONRIGHT\00"
+data(97) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SENETWORKLOGONRIGHT\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(15) = "DN=@ATTRIBUTES\00"
+data(88) = "g\19\01&\02\00\00\00@ATTRIBUTES\00comment\00\01\00\00\00\10\00\00\00CASE_INSENSITIVE\00privilege\00\01\00\00\00\10\00\00\00CASE_INSENSITIVE\00"
+}
+{
+key(46) = "DN=@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJwIAAA==\00"
+data(103) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJwIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-551\00"
+}
+{
+key(20) = "DN=SID=S-1-5-32-548\00"
+data(166) = "g\19\01&\04\00\00\00sid=S-1-5-32-548\00comment\00\01\00\00\00\11\00\00\00Account Operators\00objectClass\00\01\00\00\00\09\00\00\00privilege\00objectSid\00\01\00\00\00\10\00\00\00\01\02\00\00\00\00\00\05 \00\00\00$\02\00\00\00privilege\00\01\00\00\00\17\00\00\00SeInteractiveLogonRight\00"
+}
+{
+key(44) = "DN=@INDEX:PRIVILEGE:SEMANAGEVOLUMEPRIVILEGE\00"
+data(101) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEMANAGEVOLUMEPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(43) = "DN=@INDEX:PRIVILEGE:SEIMPERSONATEPRIVILEGE\00"
+data(100) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEIMPERSONATEPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(52) = "DN=@INDEX:PRIVILEGE:SEPROFILESINGLEPROCESSPRIVILEGE\00"
+data(109) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEPROFILESINGLEPROCESSPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(52) = "DN=@INDEX:PRIVILEGE:SEINCREASEBASEPRIORITYPRIVILEGE\00"
+data(109) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEINCREASEBASEPRIORITYPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(46) = "DN=@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAIAIAAA==\00"
+data(103) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAIAIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(13) = "DN=@BASEINFO\00"
+data(81) = "g\19\01&\02\00\00\00@BASEINFO\00whenChanged\00\01\00\00\00\11\00\00\0020110608171909.0Z\00sequenceNumber\00\01\00\00\00\01\00\00\009\00"
+}
+{
+key(42) = "DN=@INDEX:PRIVILEGE:SESYSTEMTIMEPRIVILEGE\00"
+data(120) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SESYSTEMTIMEPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\02\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-549\00"
+}
+{
+key(20) = "DN=SID=S-1-5-32-551\00"
+data(234) = "g\19\01&\04\00\00\00sid=S-1-5-32-551\00comment\00\01\00\00\00\10\00\00\00Backup Operators\00objectClass\00\01\00\00\00\09\00\00\00privilege\00objectSid\00\01\00\00\00\10\00\00\00\01\02\00\00\00\00\00\05 \00\00\00'\02\00\00\00privilege\00\04\00\00\00\11\00\00\00SeBackupPrivilege\00\12\00\00\00SeRestorePrivilege\00\13\00\00\00SeShutdownPrivilege\00\17\00\00\00SeInteractiveLogonRight\00"
+}
+{
+key(48) = "DN=@INDEX:PRIVILEGE:SEENABLEDELEGATIONPRIVILEGE\00"
+data(105) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEENABLEDELEGATIONPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(50) = "DN=@INDEX:PRIVILEGE:SEREMOTEINTERACTIVELOGONRIGHT\00"
+data(128) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEREMOTEINTERACTIVELOGONRIGHT\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\02\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-554\00"
+}
+{
+key(45) = "DN=@INDEX:PRIVILEGE:SEINCREASEQUOTAPRIVILEGE\00"
+data(102) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEINCREASEQUOTAPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(20) = "DN=SID=S-1-5-32-544\00"
+data(804) = "g\19\01&\04\00\00\00sid=S-1-5-32-544\00comment\00\01\00\00\00\0E\00\00\00Administrators\00objectClass\00\01\00\00\00\09\00\00\00privilege\00objectSid\00\01\00\00\00\10\00\00\00\01\02\00\00\00\00\00\05 \00\00\00 \02\00\00\00privilege\00\18\00\00\00\13\00\00\00SeSecurityPrivilege\00\11\00\00\00SeBackupPrivilege\00\12\00\00\00SeRestorePrivilege\00\15\00\00\00SeSystemtimePrivilege\00\13\00\00\00SeShutdownPrivilege\00\19\00\00\00SeRemoteShutdownPrivilege\00\18\00\00\00SeTakeOwnershipPrivilege\00\10\00\00\00SeDebugPrivilege\00\1C\00\00\00SeSystemEnvironmentPrivilege\00\18\00\00\00SeSystemProfilePrivilege\00\1F\00\00\00SeProfileSingleProcessPrivilege\00\1F\00\00\00SeIncreaseBasePriorityPrivilege\00\15\00\00\00SeLoadDriverPrivilege\00\19\00\00\00SeCreatePagefilePrivilege\00\18\00\00\00SeIncreaseQuotaPrivilege\00\17\00\00\00SeChangeNotifyPrivilege\00\11\00\00\00SeUndockPrivilege\00\17\00\00\00SeManageVolumePrivilege\00\16\00\00\00SeImpersonatePrivilege\00\17\00\00\00SeCreateGlobalPrivilege\00\1B\00\00\00SeEnableDelegationPrivilege\00\17\00\00\00SeInteractiveLogonRight\00\13\00\00\00SeNetworkLogonRight\00\1D\00\00\00SeRemoteInteractiveLogonRight\00"
+}
+{
+key(38) = "DN=@INDEX:PRIVILEGE:SEBACKUPPRIVILEGE\00"
+data(137) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEBACKUPPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\03\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-551\00\10\00\00\00sid=S-1-5-32-549\00"
+}
+{
+key(20) = "DN=SID=S-1-5-32-549\00"
+data(290) = "g\19\01&\04\00\00\00sid=S-1-5-32-549\00comment\00\01\00\00\00\10\00\00\00Server Operators\00objectClass\00\01\00\00\00\09\00\00\00privilege\00objectSid\00\01\00\00\00\10\00\00\00\01\02\00\00\00\00\00\05 \00\00\00%\02\00\00\00privilege\00\06\00\00\00\11\00\00\00SeBackupPrivilege\00\15\00\00\00SeSystemtimePrivilege\00\19\00\00\00SeRemoteShutdownPrivilege\00\12\00\00\00SeRestorePrivilege\00\13\00\00\00SeShutdownPrivilege\00\17\00\00\00SeInteractiveLogonRight\00"
+}
+{
+key(40) = "DN=@INDEX:PRIVILEGE:SESHUTDOWNPRIVILEGE\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SESHUTDOWNPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\04\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-550\00\10\00\00\00sid=S-1-5-32-551\00\10\00\00\00sid=S-1-5-32-549\00"
+}
+{
+key(44) = "DN=@INDEX:PRIVILEGE:SECREATEGLOBALPRIVILEGE\00"
+data(101) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SECREATEGLOBALPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(46) = "DN=@INDEX:PRIVILEGE:SEREMOTESHUTDOWNPRIVILEGE\00"
+data(124) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEREMOTESHUTDOWNPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\02\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-549\00"
+}
+{
+key(46) = "DN=@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJAIAAA==\00"
+data(103) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJAIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-548\00"
+}
+{
+key(45) = "DN=@INDEX:PRIVILEGE:SETAKEOWNERSHIPPRIVILEGE\00"
+data(102) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SETAKEOWNERSHIPPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(49) = "DN=@INDEX:PRIVILEGE:SESYSTEMENVIRONMENTPRIVILEGE\00"
+data(106) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SESYSTEMENVIRONMENTPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(42) = "DN=@INDEX:PRIVILEGE:SELOADDRIVERPRIVILEGE\00"
+data(120) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SELOADDRIVERPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\02\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-550\00"
+}
+{
+key(39) = "DN=@INDEX:PRIVILEGE:SERESTOREPRIVILEGE\00"
+data(138) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SERESTOREPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\03\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-551\00\10\00\00\00sid=S-1-5-32-549\00"
+}
+{
+key(20) = "DN=SID=S-1-5-32-554\00"
+data(217) = "g\19\01&\04\00\00\00sid=S-1-5-32-554\00comment\00\01\00\00\00\22\00\00\00Pre-Windows 2000 Compatible Access\00objectClass\00\01\00\00\00\09\00\00\00privilege\00objectSid\00\01\00\00\00\10\00\00\00\01\02\00\00\00\00\00\05 \00\00\00*\02\00\00\00privilege\00\02\00\00\00\1D\00\00\00SeRemoteInteractiveLogonRight\00\17\00\00\00SeChangeNotifyPrivilege\00"
+}
+{
+key(46) = "DN=@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJgIAAA==\00"
+data(103) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQIAAAAAAAUgAAAAJgIAAA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-550\00"
+}
+{
+key(44) = "DN=@INDEX:PRIVILEGE:SEINTERACTIVELOGONRIGHT\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEINTERACTIVELOGONRIGHT\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\05\00\00\00\10\00\00\00sid=S-1-5-32-544\00\10\00\00\00sid=S-1-5-32-550\00\10\00\00\00sid=S-1-5-32-551\00\10\00\00\00sid=S-1-5-32-549\00\10\00\00\00sid=S-1-5-32-548\00"
+}
+{
+key(46) = "DN=@INDEX:PRIVILEGE:SECREATEPAGEFILEPRIVILEGE\00"
+data(103) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SECREATEPAGEFILEPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
+{
+key(14) = "DN=@INDEXLIST\00"
+data(60) = "g\19\01&\01\00\00\00@INDEXLIST\00@IDXATTR\00\02\00\00\00\09\00\00\00objectSid\00\09\00\00\00privilege\00"
+}
+{
+key(37) = "DN=@INDEX:PRIVILEGE:SEDEBUGPRIVILEGE\00"
+data(94) = "g\19\01&\02\00\00\00@INDEX:PRIVILEGE:SEDEBUGPRIVILEGE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\10\00\00\00sid=S-1-5-32-544\00"
+}
diff --git a/source4/selftest/provisions/alpha13/private/sam.ldb.d/CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP.ldb.dump b/source4/selftest/provisions/alpha13/private/sam.ldb.d/CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP.ldb.dump
new file mode 100644 (file)
index 0000000..bc481aa
--- /dev/null
@@ -0,0 +1,28924 @@
+{
+key(26) = "DN=@INDEX:USNCHANGED:3096\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3096\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(52) = "DN=@INDEX:NAME:CAA2BFAD-0CCA-483B-8D00-347F943292A8\00"
+data(208) = "g\19\01&\02\00\00\00@INDEX:NAME:CAA2BFAD-0CCA-483B-8D00-347F943292A8\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=caa2bfad-0cca-483b-8d00-347f943292a8,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=MSCOM-PARTITIONSET-DISPLAY,CN=419,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1519) = "g\19\01&\0F\00\00\00CN=msCOM-PartitionSet-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00msCOM-PartitionSet-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002379\00uSNChanged\00\01\00\00\00\04\00\00\002379\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00msCOM-PartitionSet-Display\00objectGUID\00\01\00\00\00\10\00\00\00\E3\14O\C2\89\BC9G\A2\DA\5C\9B\A6E\EB\AD\00replPropertyMetaData\00\01\00\00\00\F0\01\00\00\01\00\00\00\00\00\00\00\0A\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCK\09\00\00\00\00\00\00K\09\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{9305969B-F45F-47E5-A954-6EA879E874CC}\00adminContextMenu\00\01\00\00\00(\00\00\001,{EEBD2F15-87EE-4F93-856F-6AD7E31787B3}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:CN:94FDEBC6-8EEB-4640-80DE-EC52B9CA17FA\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:94FDEBC6-8EEB-4640-80DE-EC52B9CA17FA\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=94fdebc6-8eeb-4640-80de-ec52b9ca17fa,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::3XCceBM8jE2Oh72IHFKUcw==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::3XCceBM8jE2Oh72IHFKUcw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=ORGANIZATIONALUNIT-DISPLAY,CN=416,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2253) = "g\19\01&\13\00\00\00CN=organizationalUnit-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00organizationalUnit-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001789\00uSNChanged\00\01\00\00\00\04\00\00\001789\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00organizationalUnit-Display\00objectGUID\00\01\00\00\00\10\00\00\00\DB\F7\F3\13\EF\13cF\99Y\DF\DA/'+\92\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FD\06\00\00\00\00\00\00\FD\06\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\06\00\00\00(\00\00\007,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\006,{FA3E1D55-16DF-446d-872E-BD04D4F39C93}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd63-c63b-11d0-b94d-00c04fd8d5b0}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\16\00\00\00Unidade Organizacional\00adminContextMenu\00\02\00\00\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\03\00\00\00\18\00\00\00managedBy,Gerenciado por\00\17\00\00\00description,Descri\C3\A7\C3\A3o\00\07\00\00\00ou,Nome\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1601\00"
+data(146) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1601\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00O\00\00\00CN=msmq-Receive,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=SERVERSCONTAINER-DISPLAY,CN=41D,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1745) = "g\19\01&\10\00\00\00CN=serversContainer-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00serversContainer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002710\00uSNChanged\00\01\00\00\00\04\00\00\002710\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00serversContainer-Display\00objectGUID\00\01\00\00\00\10\00\00\00\18\BA\DE\D0\DC&XN\BBcIh\DE'\B2\CE\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0A\00\00\00\00\00\00\96\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\17\00\00\00Beh\C3\A5llare f\C3\B6r servrar\00adminContextMenu\00\02\00\00\00(\00\00\002,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=MSMQMIGRATEDUSER-DISPLAY,CN=401,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1620) = "g\19\01&\10\00\00\00CN=mSMQMigratedUser-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002477\00uSNChanged\00\01\00\00\00\04\00\00\002477\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00objectGUID\00\01\00\00\00\10\00\00\00\9E\FCX\B3R\0C\B7O\92p5\7F:x[\FD\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AD\09\00\00\00\00\00\00\AD\09\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00classDisplayName\00\01\00\00\00!\00\00\00\D9\85\D8\B3\D8\AA\D8\AE\D8\AF\D9\85 \D8\AA\D8\B1\D9\82\D9\8A\D8\A9 \D9\84\D9\80 MSMQ\00adminContextMenu\00\01\00\00\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2107\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2107\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::rW/q54ydVEOWBb/GJbkKHw==\00"
+data(196) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::rW/q54ydVEOWBb/GJbkKHw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::WvmHCNh0mkGVjmRdzfNrNQ==\00"
+data(193) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::WvmHCNh0mkGVjmRdzfNrNQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=licensingSiteSettings-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2806\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2806\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTFRSMember-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2729\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2729\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1872\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1872\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=queryPolicy-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1972\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1972\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::BCIyBqW+d0SuZ3M0UTNuvg==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::BCIyBqW+d0SuZ3M0UTNuvg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSSubscriber-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2532\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2532\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=NTFRSSUBSCRIPTIONS-DISPLAY,CN=40E,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1731) = "g\19\01&\10\00\00\00CN=nTFRSSubscriptions-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00nTFRSSubscriptions-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002416\00uSNChanged\00\01\00\00\00\04\00\00\002416\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00nTFRSSubscriptions-Display\00objectGUID\00\01\00\00\00\10\00\00\00__\C4\DB\9F\BF$B\A9r\DEF\FB\09{\22\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCp\09\00\00\00\00\00\00p\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30560-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\000\00\00\00F\C3\A1jlreplik\C3\A1ci\C3\B3s szolg\C3\A1ltat\C3\A1s el\C5\91fizet\C3\A9sei\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=MSCOM-PARTITIONSET-DISPLAY,CN=408,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1519) = "g\19\01&\0F\00\00\00CN=msCOM-PartitionSet-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00msCOM-PartitionSet-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002323\00uSNChanged\00\01\00\00\00\04\00\00\002323\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00msCOM-PartitionSet-Display\00objectGUID\00\01\00\00\00\10\00\00\00`\E1S\CB\A6\FE\DDA\AC)\14\C5]\B5#`\00replPropertyMetaData\00\01\00\00\00\F0\01\00\00\01\00\00\00\00\00\00\00\0A\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\09\00\00\00\00\00\00\13\09\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{9305969B-F45F-47E5-A954-6EA879E874CC}\00adminContextMenu\00\01\00\00\00(\00\00\001,{EEBD2F15-87EE-4F93-856F-6AD7E31787B3}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1895\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1895\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=nTDSSettings-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2455\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2455\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=nTDSSettings-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3015\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3015\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00o\00\00\00CN=interSiteTransportContainer-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=DS-UI-DEFAULT-SETTINGS,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1680) = "g\19\01&\10\00\00\00CN=DS-UI-Default-Settings,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\0C\00\00\00dSUISettings\00cn\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002832\00uSNChanged\00\01\00\00\00\04\00\00\002832\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00objectGUID\00\01\00\00\00\10\00\00\00\A6\F4\8DE\DC\B1zJ\9C\8A\A2\0B\8A]\84\BC\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00?\05\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\99\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\A7\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\0B\00\00\00\00\00\00\10\0B\00\00\00\00\00\00\00objectCategory\00\01\00\00\00H\00\00\00CN=DS-UI-Settings,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00dSUIAdminNotification\00\02\00\00\00(\00\00\002,{a00e1768-4a9b-4d97-afc6-99d329f605f2}\00(\00\00\001,{E62F8206-B71C-11D1-808D-00A024C48131}\00msDS-Non-Security-Group-Extra-Classes\00\02\00\00\00\13\00\00\00mSMQCustomRecipient\00\09\00\00\00mSMQQueue\00msDS-FilterContainers\00\05\00\00\00\08\00\00\00dns-Zone\00\09\00\00\00Container\00\0E\00\00\00Lost-And-Found\00\0E\00\00\00Builtin-Domain\00\13\00\00\00Organizational-Unit\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2378\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2378\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=ORGANIZATIONALUNIT-DISPLAY,CN=405,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2251) = "g\19\01&\13\00\00\00CN=organizationalUnit-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00organizationalUnit-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002797\00uSNChanged\00\01\00\00\00\04\00\00\002797\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00organizationalUnit-Display\00objectGUID\00\01\00\00\00\10\00\00\00 \17M\E6T\CE\11F\97\81@\04\0C\8B\A9\04\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\ED\0A\00\00\00\00\00\00\ED\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\06\00\00\00(\00\00\007,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\006,{FA3E1D55-16DF-446d-872E-BD04D4F39C93}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd63-c63b-11d0-b94d-00c04fd8d5b0}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\16\00\00\00Organiza\C4\8Dn\C3\AD jednotka\00adminContextMenu\00\02\00\00\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\03\00\00\00\1A\00\00\00managedBy,Spr\C3\A1vce objektu\00\11\00\00\00description,Popis\00\09\00\00\00ou,Jm\C3\A9no\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(17) = "DN=@INDEX:CN:405\00"
+data(130) = "g\19\01&\02\00\00\00@INDEX:CN:405\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2181\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2181\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=organizationalUnit-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::fVEVxCkR50muVGgOxgWmGA==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::fVEVxCkR50muVGgOxgWmGA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=subnetContainer-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2880\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2880\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=queryPolicy-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2916\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2916\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=siteLinkBridge-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2839\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2839\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=domainPolicy-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(101) = "DN=CN=NTFRSSETTINGS-DISPLAY,CN=40C,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1683) = "g\19\01&\10\00\00\00CN=nTFRSSettings-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\15\00\00\00nTFRSSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001840\00uSNChanged\00\01\00\00\00\04\00\00\001840\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\15\00\00\00nTFRSSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00c\C2hA\1DI:K\AA\03p|\D5\8B\0A\C3\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\07\00\00\00\00\00\000\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd68-c63b-11d0-b94d-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\0F\00\00\00Param\C3\A8tres FRS\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::daqBufClbEGU4RvB1/DRfQ==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::daqBufClbEGU4RvB1/DRfQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::A32Kttw1DUyZ0pmbARjrFQ==\00"
+data(180) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::A32Kttw1DUyZ0pmbARjrFQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2642\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2642\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2565\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2565\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=site-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Spf8KYrraEWlzdfrVIOYNg==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Spf8KYrraEWlzdfrVIOYNg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=siteLinkBridge-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3125\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3125\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=siteLinkBridge-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2488\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2488\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=queryPolicy-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3048\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3048\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=container-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::vgmKtAgd/kSwsBjPxCctIg==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::vgmKtAgd/kSwsBjPxCctIg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(112) = "DN=CN=FOREIGNSECURITYPRINCIPAL-DISPLAY,CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1842) = "g\19\01&\11\00\00\00CN=foreignSecurityPrincipal-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003020\00uSNChanged\00\01\00\00\00\04\00\00\003020\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00objectGUID\00\01\00\00\00\10\00\00\00\5Crt\82E\95\D1C\95\C7\7F\C8\D7a\0D\EC\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CC\0B\00\00\00\00\00\00\CC\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6486-a212-11d0-bcd5-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\1C\00\00\00Yabanc\C4\B1 G\C3\BCvenlik Sorumlusu\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\16\00\00\00description,A\C3\A7\C4\B1klama\00\07\00\00\00cn,Ad\C4\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(41) = "DN=@INDEX:NAME:MSMQCONFIGURATION-DISPLAY\00"
+data(2727) = "g\19\01&\02\00\00\00@INDEX:NAME:MSMQCONFIGURATION-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::3E4oqSL3vU6zx/nsO3HV4A==\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::3E4oqSL3vU6zx/nsO3HV4A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2990\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2990\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(96) = "DN=CN=COMPUTER-DISPLAY,CN=401,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2758) = "g\19\01&\15\00\00\00CN=computer-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\10\00\00\00computer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002451\00uSNChanged\00\01\00\00\00\04\00\00\002451\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\10\00\00\00computer-Display\00objectGUID\00\01\00\00\00\10\00\00\00\D6f\F5\83\E6\8A~C\84\9B\BDQ\1CO?\1E\00replPropertyMetaData\00\01\00\00\00\10\03\00\00\01\00\00\00\00\00\00\00\10\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00,\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\93\09\00\00\00\00\00\00\93\09\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\09\00\00\00)\00\00\0012,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00)\00\00\0011,{c7499700-f96b-11d2-ac78-0008c7726cf7}\00)\00\00\0010,{0F65B1BF-740F-11d1-BBE6-0060081692B3}\00(\00\00\007,{B52C1E50-1DD2-11D1-BC43-00C04FC31FD3}\00(\00\00\006,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\005,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\004,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{77597368-7b15-11d0-a0c2-080036af3f03}\00(\00\00\001,{6dfe6492-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f4-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\12\00\00\00\D8\A7\D9\84\D9\83\D9\85\D8\A8\D9\8A\D9\88\D8\AA\D8\B1\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\07\00\00\007\00\00\00MSDS-PhoneticDisplayName,\D8\A7\D8\B3\D9\85 \D8\A7\D9\84\D8\B9\D8\B1\D8\B6 \D8\A7\D9\84\D8\B5\D9\88\D8\AA\D9\8A\00C\00\00\00samAccountName,\D8\A7\D8\B3\D9\85 \D8\A7\D9\84\D9\83\D9\85\D8\A8\D9\8A\D9\88\D8\AA\D8\B1 (\D9\85\D8\A7 \D9\82\D8\A8\D9\84 Windows 2000)\009\00\00\00operatingSystemVersion,\D8\A5\D8\B5\D8\AF\D8\A7\D8\B1 \D9\86\D8\B8\D8\A7\D9\85 \D8\A7\D9\84\D8\AA\D8\B4\D8\BA\D9\8A\D9\84\00'\00\00\00operatingSystem,\D9\86\D8\B8\D8\A7\D9\85 \D8\A7\D9\84\D8\AA\D8\B4\D8\BA\D9\8A\D9\84\00)\00\00\00managedBy,\D9\8A\D8\AA\D9\85 \D8\A5\D8\AF\D8\A7\D8\B1\D8\AA\D9\87 \D9\85\D9\86 \D9\82\D8\A8\D9\84\00\16\00\00\00description,\D8\A7\D9\84\D9\88\D8\B5\D9\81\00\0D\00\00\00cn,\D8\A7\D9\84\D8\A7\D8\B3\D9\85\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00createWizardExt\00\01\00\00\00(\00\00\001,{D6D8C25A-4E83-11d2-8424-00C04FA372D4}\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::muxhS3dDBEmkbYs0mh4idQ==\00"
+data(198) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::muxhS3dDBEmkbYs0mh4idQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::YOFTy6b+3UGsKRTFXbUjYA==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::YOFTy6b+3UGsKRTFXbUjYA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=msCOM-PartitionSet-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::lmbae8PROE28PWFUs+YXwg==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::lmbae8PROE28PWFUs+YXwg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(96) = "DN=CN=SITELINK-DISPLAY,CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1671) = "g\19\01&\10\00\00\00CN=siteLink-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\10\00\00\00siteLink-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003051\00uSNChanged\00\01\00\00\00\04\00\00\003051\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\10\00\00\00siteLink-Display\00objectGUID\00\01\00\00\00\10\00\00\00\FFy\B7\D9G\E4\98F\93c\F8\E9v)\85a\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EB\0B\00\00\00\00\00\00\EB\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30561-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\12\00\00\00Site Ba\C4\9Flant\C4\B1s\C4\B1\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::hLcllsBtFEmdAN1LJuaihQ==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::hLcllsBtFEmdAN1LJuaihQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(42) = "DN=@INDEX:OBJECTCLASS:MSDS-QUOTACONTAINER\00"
+data(142) = "g\19\01&\02\00\00\00@INDEX:OBJECTCLASS:MSDS-QUOTACONTAINER\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00;\00\00\00CN=NTDS Quotas,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=NTDSDSA-DISPLAY,CN=40E,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1684) = "g\19\01&\10\00\00\00CN=nTDSDSA-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00nTDSDSA-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002402\00uSNChanged\00\01\00\00\00\04\00\00\002402\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00nTDSDSA-Display\00objectGUID\00\01\00\00\00\10\00\00\00\87)(\D1=\A7\1DE\AC\84\F2\CB{\13\9Eo\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCb\09\00\00\00\00\00\00b\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{717EF4FC-AC8D-11D0-B945-00C04FD8D5B0}\00classDisplayName\00\01\00\00\00\22\00\00\00Tartom\C3\A1nyvez\C3\A9rl\C5\91 be\C3\A1ll\C3\ADt\C3\A1sai\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1924\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1924\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00o\00\00\00CN=interSiteTransportContainer-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2407\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2407\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1847\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1847\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::QL1L+EYeQUeWoSUsMkcsmQ==\00"
+data(194) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::QL1L+EYeQUeWoSUsMkcsmQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2210\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2210\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2133\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2133\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2056\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2056\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2481\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2481\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::P8ZYxp0ONk29+BD+eIadCQ==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::P8ZYxp0ONk29+BD+eIadCQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=nTDSDSA-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2517\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2517\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=organizationalUnit-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(31) = "DN=@INDEX:NAME:EXTENDED-RIGHTS\00"
+data(135) = "g\19\01&\02\00\00\00@INDEX:NAME:EXTENDED-RIGHTS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00?\00\00\00CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(109) = "DN=CN=MSMQ-CUSTOM-RECIPIENT-DISPLAY,CN=804,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2008) = "g\19\01&\13\00\00\00CN=msMQ-Custom-Recipient-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1D\00\00\00msMQ-Custom-Recipient-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001920\00uSNChanged\00\01\00\00\00\04\00\00\001920\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1D\00\00\00msMQ-Custom-Recipient-Display\00objectGUID\00\01\00\00\00\10\00\00\00\00\17\C9`,\ED\15O\87gc\7F:MU\1C\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\F2\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\80\07\00\00\00\00\00\00\80\07\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-437\00creationWizard\00\01\00\00\00&\00\00\00{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\001,{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00classDisplayName\00\01\00\00\00\11\00\00\00MSMQ \E9\98\9F\E5\88\97\E5\88\AB\E5\90\8D\00adminContextMenu\00\01\00\00\00(\00\00\001,{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00attributeDisplayNames\00\03\00\00\00#\00\00\00msMQ-Recipient-FormatName,\E6\A0\BC\E5\BC\8F\E5\90\8D\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00cn,\E5\90\8D\E7\A7\B0\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2166\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2166\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2089\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2089\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2942\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2942\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=msCOM-Partition-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2865\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2865\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=rpcContainer-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2788\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2788\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(88) = "DN=CN=OPEN-ADDRESS-BOOK,CN=EXTENDED-RIGHTS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1661) = "g\19\01&\12\00\00\00CN=Open-Address-Book,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\12\00\00\00controlAccessRight\00cn\00\01\00\00\00\11\00\00\00Open-Address-Book\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00displayName\00\01\00\00\00\11\00\00\00Open Address List\00uSNCreated\00\01\00\00\00\04\00\00\001645\00uSNChanged\00\01\00\00\00\04\00\00\001645\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00Open-Address-Book\00objectGUID\00\01\00\00\00\10\00\00\00\DD\BC\92;\FA\E2\EDC\B5;\AD\81\CA\FD\01:\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\0D\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00T\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00U\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00I\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00L\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCm\06\00\00\00\00\00\00m\06\00\00\00\00\00\00\00rightsGuid\00\01\00\00\00$\00\00\00a1990816-4298-11d1-ade2-00c04fd8d5cd\00appliesTo\00\01\00\00\00$\00\00\003e74f60f-3e73-11d1-a9c0-0000f80367c1\00objectCategory\00\01\00\00\00N\00\00\00CN=Control-Access-Right,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00localizationDisplayId\00\01\00\00\00\02\00\00\0021\00validAccesses\00\01\00\00\00\03\00\00\00256\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3151\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3151\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=msCOM-Partition-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:CN:USER-DISPLAY\00"
+data(2387) = "g\19\01&\02\00\00\00@INDEX:CN:USER-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00X\00\00\00CN=user-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2591\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2591\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3074\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3074\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=MSMQQUEUE-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1842) = "g\19\01&\13\00\00\00CN=mSMQQueue-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00mSMQQueue-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002866\00uSNChanged\00\01\00\00\00\04\00\00\002866\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00mSMQQueue-Display\00objectGUID\00\01\00\00\00\10\00\00\00\EA\88\D2O\84\F4\96K\95`\F4\E3~~\DB\9B\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\F2\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\0B\00\00\00\00\00\002\0B\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-251\00creationWizard\00\01\00\00\00&\00\00\00{E62F8206-B71C-11D1-808D-00A024C48131}\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{e62f8206-b71c-11d1-808d-00a024c48131}\00classDisplayName\00\01\00\00\00\0A\00\00\00MSMQ Queue\00adminContextMenu\00\01\00\00\00(\00\00\001,{e62f8206-b71c-11d1-808d-00a024c48131}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::fdzYSOwqYkOT2bB+cs4vCg==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::fdzYSOwqYkOT2bB+cs4vCg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=rpcContainer-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3097\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3097\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=domainPolicy-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::EOK/td62h0m+UsLTO1ajPw==\00"
+data(189) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::EOK/td62h0m+UsLTO1ajPw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1602\00"
+data(143) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1602\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00L\00\00\00CN=msmq-Peek,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(98) = "DN=CN=MSMQ-GROUP-DISPLAY,CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1717) = "g\19\01&\11\00\00\00CN=msMQ-Group-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\12\00\00\00msMQ-Group-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002761\00uSNChanged\00\01\00\00\00\04\00\00\002761\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\12\00\00\00msMQ-Group-Display\00objectGUID\00\01\00\00\00\10\00\00\00\AA\E4c\C8\5CM\9EB\A3\5C::\FFE\9E\E8\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C9\0A\00\00\00\00\00\00\C9\0A\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{7e93454a-976a-4228-90f1-f7648010b8e6}\00classDisplayName\00\01\00\00\00\0B\00\00\00Gruppo MSMQ\00adminContextMenu\00\01\00\00\00(\00\00\001,{7e93454a-976a-4228-90f1-f7648010b8e6}\00attributeDisplayNames\00\03\00\00\00\12\00\00\00member,Code membri\00\17\00\00\00description,Descrizione\00\07\00\00\00cn,Nome\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2008\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2008\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(115) = "DN=CN=INTERSITETRANSPORTCONTAINER-DISPLAY,CN=405,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1789) = "g\19\01&\10\00\00\00CN=interSiteTransportContainer-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00#\00\00\00interSiteTransportContainer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002820\00uSNChanged\00\01\00\00\00\04\00\00\002820\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00#\00\00\00interSiteTransportContainer-Display\00objectGUID\00\01\00\00\00\10\00\00\00\0F\8C\A9V?\C0\96N\99\D3\EF\8E\D5\F6\86Q\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\04\0B\00\00\00\00\00\00\04\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\22\00\00\00Kontejner mezis\C3\AD\C5\A5ov\C3\A9ho p\C5\99enosu\00adminContextMenu\00\02\00\00\00(\00\00\002,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::g+DTverDR0W4IK909X58EA==\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::g+DTverDR0W4IK909X58EA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=ORGANIZATIONALUNIT-DISPLAY,CN=41D,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2246) = "g\19\01&\13\00\00\00CN=organizationalUnit-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00organizationalUnit-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002685\00uSNChanged\00\01\00\00\00\04\00\00\002685\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00organizationalUnit-Display\00objectGUID\00\01\00\00\00\10\00\00\00\16\DD\F2hOB\00H\9E\95\E4\08\C5\B4zL\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC}\0A\00\00\00\00\00\00}\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\06\00\00\00(\00\00\007,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\006,{FA3E1D55-16DF-446d-872E-BD04D4F39C93}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd63-c63b-11d0-b94d-00c04fd8d5b0}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\12\00\00\00Organisationsenhet\00adminContextMenu\00\02\00\00\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\03\00\00\00\15\00\00\00managedBy,Hanterad av\00\17\00\00\00description,Beskrivning\00\07\00\00\00ou,Namn\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=LOSTANDFOUND-DISPLAY,CN=412,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2071) = "g\19\01&\13\00\00\00CN=lostAndFound-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00lostAndFound-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001989\00uSNChanged\00\01\00\00\00\04\00\00\001989\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00lostAndFound-Display\00objectGUID\00\01\00\00\00\10\00\00\00\CB\CB\19\89A\B5)E\92%\09\E5\84\A3\BE\03\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\97\06\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C5\07\00\00\00\00\00\00\C5\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00adminContextMenu\00\01\00\00\00(\00\00\000,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\EC\84\A4\EB\AA\85\00\09\00\00\00cn,\EC\9D\B4\EB\A6\84\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00extraColumns\00\01\00\00\008\00\00\00lastKnownParent,\EB\A7\88\EC\A7\80\EB\A7\89\EC\9C\BC\EB\A1\9C \EC\95\8C\EB\A0\A4\EC\A7\84 \EB\B6\80\EB\AA\A8,1,300,0\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30563-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::iYIWAag/eUyPDJN+jMvBdw==\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::iYIWAag/eUyPDJN+jMvBdw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1950\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1950\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=server-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1873\00"
+data(175) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1873\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1796\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1796\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=licensingSiteSettings-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1909\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1909\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::JHDxccLssEik99JGk8ytJQ==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::JHDxccLssEik99JGk8ytJQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=msCOM-Partition-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(90) = "DN=CN=DS-QUERY-SELF-QUOTA,CN=EXTENDED-RIGHTS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1666) = "g\19\01&\12\00\00\00CN=DS-Query-Self-Quota,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\12\00\00\00controlAccessRight\00cn\00\01\00\00\00\13\00\00\00DS-Query-Self-Quota\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00displayName\00\01\00\00\00\10\00\00\00Query Self Quota\00uSNCreated\00\01\00\00\00\04\00\00\001633\00uSNChanged\00\01\00\00\00\04\00\00\001633\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00DS-Query-Self-Quota\00objectGUID\00\01\00\00\00\10\00\00\00`\DF/\97-\C4\9DO\9B'\16\1B\D7\1F\8B(\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\0D\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00T\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00U\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00I\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00L\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCa\06\00\00\00\00\00\00a\06\00\00\00\00\00\00\00rightsGuid\00\01\00\00\00$\00\00\004ecc03fe-ffc0-4947-b630-eb672a8a9dbc\00appliesTo\00\01\00\00\00$\00\00\00da83fc4f-076f-4aea-b4dc-8f4dab9b5993\00objectCategory\00\01\00\00\00N\00\00\00CN=Control-Access-Right,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00localizationDisplayId\00\01\00\00\00\02\00\00\0071\00validAccesses\00\01\00\00\00\03\00\00\00256\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2082\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2082\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2118\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2118\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=server-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=RPCCONTAINER-DISPLAY,CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1899) = "g\19\01&\12\00\00\00CN=rpcContainer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00rpcContainer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002753\00uSNChanged\00\01\00\00\00\04\00\00\002753\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00rpcContainer-Display\00objectGUID\00\01\00\00\00\10\00\00\00\89{\06\00r6\C2G\B6\BD\8D,\8C\83B\CB\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\0A\00\00\00\00\00\00\C1\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30572-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\0B\00\00\00Servizi RPC\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\17\00\00\00description,Descrizione\00\07\00\00\00cn,Nome\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=LOSTANDFOUND-DISPLAY,CN=C0A,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2071) = "g\19\01&\13\00\00\00CN=lostAndFound-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00lostAndFound-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002661\00uSNChanged\00\01\00\00\00\04\00\00\002661\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00lostAndFound-Display\00objectGUID\00\01\00\00\00\10\00\00\00k\E7\FEs\1AL\0BJ\B9\FC\FD/\BB\94\D7;\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\97\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCe\0A\00\00\00\00\00\00e\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00adminContextMenu\00\01\00\00\00(\00\00\000,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\18\00\00\00description,Descripci\C3\B3n\00\09\00\00\00cn,Nombre\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00extraColumns\00\01\00\00\002\00\00\00lastKnownParent,Principal \C3\BAltimo conocido,1,300,0\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30563-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2917\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2917\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::rlKaXsjdoUyYk5qROfLTgg==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::rlKaXsjdoUyYk5qROfLTgg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=default-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2620\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2620\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1983\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1983\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTDSService-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2543\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2543\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTDSService-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(113) = "DN=CN=REMOTESTORAGESERVICEPOINT-DISPLAY,CN=419,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1920) = "g\19\01&\12\00\00\00CN=remoteStorageServicePoint-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002370\00uSNChanged\00\01\00\00\00\04\00\00\002370\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00objectGUID\00\01\00\00\00\10\00\00\00\BDM\14\DA\A2\0E\1CF\AD\96\5C\05s\1C\CF\EC\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00&\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\09\00\00\00\00\00\00B\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00,\00\00\00\D0\A1\D0\BB\D1\83\D0\B6\D0\B1\D0\B0 \D0\B2\D0\BD\D0\B5\D1\88\D0\BD\D0\B8\D1\85 \D1\85\D1\80\D0\B0\D0\BD\D0\B8\D0\BB\D0\B8\D1\89\00adminContextMenu\00\01\00\00\00&\00\00\000,&\D0\A3\D0\BF\D1\80\D0\B0\D0\B2\D0\BB\D0\B5\D0\BD\D0\B8\D0\B5...,RsAdmin.msc\00attributeDisplayNames\00\01\00\00\00\16\00\00\00cn,\D0\9F\D0\BE\D0\BB\D0\BD\D0\BE\D0\B5 \D0\B8\D0\BC\D1\8F\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3126\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3126\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2466\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2466\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=siteLinkBridge-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(103) = "DN=CN=MSCOM-PARTITION-DISPLAY,CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1396) = "g\19\01&\0E\00\00\00CN=msCOM-Partition-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\17\00\00\00msCOM-Partition-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003023\00uSNChanged\00\01\00\00\00\04\00\00\003023\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\17\00\00\00msCOM-Partition-Display\00objectGUID\00\01\00\00\00\10\00\00\00B\B0\84g\DC\7F\D0F\91\D4l\90\82\B2\87\89\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\0B\00\00\00\00\00\00\CF\0B\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{2797CF92-415A-43E6-A8F7-A5FAAB783719}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3049\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3049\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2389\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2389\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2192\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2192\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::qfiuXmdpKk+XC4ad8Go1iA==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::qfiuXmdpKk+XC4ad8Go1iA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(43) = "DN=@INDEX:CN:WELLKNOWN SECURITY PRINCIPALS\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:CN:WELLKNOWN SECURITY PRINCIPALS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00M\00\00\00CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::oAgOskBdbE6rGTBJu9/ezA==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::oAgOskBdbE6rGTBJu9/ezA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2991\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2991\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=MSMQMIGRATEDUSER-DISPLAY,CN=816,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1621) = "g\19\01&\10\00\00\00CN=mSMQMigratedUser-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002085\00uSNChanged\00\01\00\00\00\04\00\00\002085\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00objectGUID\00\01\00\00\00\10\00\00\00\C8\AE\B3\C5\1CQ\DBO\97\A6\B0\8C\BDP\F27\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC%\08\00\00\00\00\00\00%\08\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00classDisplayName\00\01\00\00\00\22\00\00\00Utilizador com Actualiza\C3\A7\C3\A3o MSMQ\00adminContextMenu\00\01\00\00\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::T7uokzuzIUS/HHmcatgOyg==\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::T7uokzuzIUS/HHmcatgOyg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::YGYxQpY4bkCiXynytc3y8Q==\00"
+data(194) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::YGYxQpY4bkCiXynytc3y8Q==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(92) = "DN=CN=SITE-DISPLAY,CN=413,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1828) = "g\19\01&\10\00\00\00CN=site-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0C\00\00\00site-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002565\00uSNChanged\00\01\00\00\00\04\00\00\002565\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0C\00\00\00site-Display\00objectGUID\00\01\00\00\00\10\00\00\00\F7\0D\0Buv\11XJ\8D\13\A1+\F0\F7\9Ex\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0A\00\00\00\00\00\00\05\0A\00\00\00\00\00\00\00adminPropertyPages\00\06\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{bc019ba0-d46d-11d1-8091-00a024c48131}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\002,{77597368-7b15-11d0-a0c2-080036af3f03}\00(\00\00\001,{717EF4FA-AC8D-11D0-B945-00C04FD8D5B0}\00classDisplayName\00\01\00\00\00\07\00\00\00Website\00adminContextMenu\00\03\00\00\00(\00\00\003,{bc019ba0-d46d-11d1-8091-00a024c48131}\00(\00\00\002,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(96) = "DN=CN=COMPUTER-DISPLAY,CN=804,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2667) = "g\19\01&\15\00\00\00CN=computer-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\10\00\00\00computer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001891\00uSNChanged\00\01\00\00\00\04\00\00\001891\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\10\00\00\00computer-Display\00objectGUID\00\01\00\00\00\10\00\00\00\11<\D8\D6G!\8EJ\9E|\91\D0\13\87\D0\1A\00replPropertyMetaData\00\01\00\00\00\10\03\00\00\01\00\00\00\00\00\00\00\10\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00&\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00,\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCc\07\00\00\00\00\00\00c\07\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\09\00\00\00)\00\00\0012,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00)\00\00\0011,{c7499700-f96b-11d2-ac78-0008c7726cf7}\00)\00\00\0010,{0F65B1BF-740F-11d1-BBE6-0060081692B3}\00(\00\00\007,{B52C1E50-1DD2-11D1-BC43-00C04FC31FD3}\00(\00\00\006,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\005,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\004,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{77597368-7b15-11d0-a0c2-080036af3f03}\00(\00\00\001,{6dfe6492-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f4-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\09\00\00\00\E8\AE\A1\E7\AE\97\E6\9C\BA\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\07\00\00\00+\00\00\00MSDS-PhoneticDisplayName,\E6\8B\BC\E9\9F\B3\E6\98\BE\E7\A4\BA\E5\90\8D\E7\A7\B0\006\00\00\00samAccountName,\E8\AE\A1\E7\AE\97\E6\9C\BA\E5\90\8D(Windows 2000 \E4\BB\A5\E5\89\8D\E7\89\88\E6\9C\AC)\00)\00\00\00operatingSystemVersion,\E6\93\8D\E4\BD\9C\E7\B3\BB\E7\BB\9F\E7\89\88\E6\9C\AC\00\1C\00\00\00operatingSystem,\E6\93\8D\E4\BD\9C\E7\B3\BB\E7\BB\9F\00\13\00\00\00managedBy,\E7\AE\A1\E7\90\86\E8\80\85\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00cn,\E5\90\8D\E7\A7\B0\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00createWizardExt\00\01\00\00\00(\00\00\001,{D6D8C25A-4E83-11d2-8424-00C04FA372D4}\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::HWjARRRrQ02gffLOaEC6nQ==\00"
+data(194) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::HWjARRRrQ02gffLOaEC6nQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Pyb6AAOu5UGs296VyXAAhg==\00"
+data(194) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Pyb6AAOu5UGs296VyXAAhg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1902\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1902\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=container-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1825\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1825\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=IntellimirrorGroup-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::AUcyo9jJUkGh5s9aiwqJcA==\00"
+data(189) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::AUcyo9jJUkGh5s9aiwqJcA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2111\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2111\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=domainPolicy-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(93) = "DN=CN=GROUP-DISPLAY,CN=414,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2539) = "g\19\01&\14\00\00\00CN=group-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0D\00\00\00group-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002220\00uSNChanged\00\01\00\00\00\04\00\00\002220\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0D\00\00\00group-Display\00objectGUID\00\01\00\00\00\10\00\00\00\83\988\92.\06%C\BD\10\A08,\12\11w\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00&\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\08\00\00\00\00\00\00\AC\08\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\06\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{9a899a50-f96b-11d2-ac78-0008c7726cf7}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\002,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6489-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ee-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\06\00\00\00Gruppe\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\0D\00\00\00\17\00\00\00wWWHomePage,Web-adresse\00 \00\00\00url,Adresse til Web-side (andre)\00,\00\00\00samAccountName,Gruppenavn (pre-Windows 2000)\00!\00\00\00physicalDeliveryOfficeName,Kontor\00\0E\00\00\00info,Merknader\00/\00\00\00mSDS-PhoneticDisplayName,Visningsnavn, fonetisk\00\10\00\00\00member,Medlemmer\00\16\00\00\00managedBy,Behandles av\00\0A\00\00\00l,Poststed\00\1C\00\00\00distinguishedName,Unikt navn\00\17\00\00\00description,Beskrivelse\00\12\00\00\00c,Landsforkortelse\00\07\00\00\00cn,Navn\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(113) = "DN=CN=REMOTESTORAGESERVICEPOINT-DISPLAY,CN=415,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1874) = "g\19\01&\12\00\00\00CN=remoteStorageServicePoint-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002932\00uSNChanged\00\01\00\00\00\04\00\00\002932\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00objectGUID\00\01\00\00\00\10\00\00\00\93\F2\F1\E0U\05\BEN\93\E6^\07S\D0\8F\06\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCt\0B\00\00\00\00\00\00t\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\16\00\00\00Us\C5\82uga Magazyn zdalny\00adminContextMenu\00\01\00\00\00\1C\00\00\000,&Zarz\C4\85dzaj...,RsAdmin.msc\00attributeDisplayNames\00\01\00\00\00\08\00\00\00cn,Nazwa\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1935\00"
+data(139) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1935\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2518\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2518\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=container-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1858\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1858\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(92) = "DN=CN=USER-DISPLAY,CN=411,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(4660) = "g\19\01&\15\00\00\00CN=user-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0C\00\00\00user-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003093\00uSNChanged\00\01\00\00\00\04\00\00\003093\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0C\00\00\00user-Display\00objectGUID\00\01\00\00\00\10\00\00\00\96\14$\E7\9Bp\9AC\8F\C3\F7.\A0S:\1F\00replPropertyMetaData\00\01\00\00\00\10\03\00\00\01\00\00\00\00\00\00\00\10\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\003\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00&\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\15\0C\00\00\00\00\00\00\15\0C\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\0B\00\00\00)\00\00\0012,{2B36667C-0729-4e7f-840A-E2E546D9D99C}\00)\00\00\0011,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00)\00\00\0010,{4c796c30-f96b-11d2-ac78-0008c7726cf7}\00(\00\00\009,{FA3E1D55-16DF-446d-872E-BD04D4F39C93}\00(\00\00\008,{0910dd01-df8c-11d1-ae27-00c04fa35813}\00(\00\00\007,{8c5b1b50-d46e-11d1-8091-00a024c48131}\00(\00\00\006,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\005,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\004,{FD57D295-4FD9-11D1-854E-00C04FC31FD3}\00(\00\00\003,{B52C1E50-1DD2-11D1-BC43-00C04FC31FD3}\00(\00\00\001,{6dfe6485-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ed-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0C\00\00\00\E3\83\A6\E3\83\BC\E3\82\B6\E3\83\BC\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00<\00\00\00&\00\00\00wWWHomePage,Web \E3\83\9A\E3\83\BC\E3\82\B8 \E3\82\A2\E3\83\89\E3\83\AC\E3\82\B9\00!\00\00\00userPrincipalName,\E3\83\AD\E3\82\B0\E3\82\AA\E3\83\B3\E5\90\8D\00A\00\00\00userWorkstations,\E3\83\AD\E3\82\B0\E3\82\AA\E3\83\B3\E3\81\A7\E3\81\8D\E3\82\8B\E3\83\AF\E3\83\BC\E3\82\AF\E3\82\B9\E3\83\86\E3\83\BC\E3\82\B7\E3\83\A7\E3\83\B3\00\15\00\00\00displayName,\E8\A1\A8\E7\A4\BA\E5\90\8D\00*\00\00\00url,Web \E3\83\9A\E3\83\BC\E3\82\B8 \E3\82\A2\E3\83\89\E3\83\AC\E3\82\B9 (\E3\81\9D\E3\81\AE\E4\BB\96)\00\0C\00\00\00title,\E5\BD\B9\E8\81\B7\00-\00\00\00telexNumber,\E3\83\86\E3\83\AC\E3\83\83\E3\82\AF\E3\82\B9\E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\00\1C\00\00\00telephoneNumber,\E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7\00\14\00\00\00streetAddress,\E7\95\AA\E5\9C\B0\00\0F\00\00\00st,\E9\83\BD\E9\81\93\E5\BA\9C\E7\9C\8C\00\06\00\00\00sn,\E5\A7\93\007\00\00\00samAccountName,\E3\83\AD\E3\82\B0\E3\82\AA\E3\83\B3\E5\90\8D (Windows 2000 \E3\82\88\E3\82\8A\E5\89\8D)\00(\00\00\00primaryTelexNumber,\E3\83\86\E3\83\AC\E3\83\83\E3\82\AF\E3\82\B9\E7\95\AA\E5\8F\B7\001\00\00\00primaryInternationalISDNNumber,\E5\9B\BD\E9\9A\9B ISDN \E7\95\AA\E5\8F\B7\00\17\00\00\00postOfficeBox,\E7\A7\81\E6\9B\B8\E7\AE\B1\00\17\00\00\00postalCode,\E9\83\B5\E4\BE\BF\E7\95\AA\E5\8F\B7\00$\00\00\00physicalDeliveryOfficeName,\E4\BA\8B\E6\A5\AD\E6\89\80\00\14\00\00\00personalTitle,\E6\95\AC\E7\A7\B0\00\1E\00\00\00pager,\E3\83\9D\E3\82\B1\E3\83\83\E3\83\88\E3\83\99\E3\83\AB\E7\95\AA\E5\8F\B7\00'\00\00\00otherTelephone,\E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\00/\00\00\00otherPager,\E3\83\9D\E3\82\B1\E3\83\83\E3\83\88\E3\83\99\E3\83\AB\E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\00*\00\00\00otherMobile,\E6\90\BA\E5\B8\AF\E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\005\00\00\00otherMailbox,\E9\9B\BB\E5\AD\90\E3\83\A1\E3\83\BC\E3\83\AB \E3\82\A2\E3\83\89\E3\83\AC\E3\82\B9 (\E3\81\9D\E3\81\AE\E4\BB\96)\00(\00\00\00otherIpPhone,IP \E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\00-\00\00\00otherHomePhone,\E8\87\AA\E5\AE\85\E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\004\00\00\00otherFacsimileTelephoneNumber,FAX \E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\00\0B\00\00\00info,\E3\83\A1\E3\83\A2\00-\00\00\00mSDS-PhoneticDepartment,\E3\83\95\E3\83\AA\E3\82\AC\E3\83\8A (\E9\83\A8\E7\BD\B2)\001\00\00\00mSDS-PhoneticCompanyName,\E3\83\95\E3\83\AA\E3\82\AC\E3\83\8A (\E4\BC\9A\E7\A4\BE\E5\90\8D)\001\00\00\00mSDS-PhoneticDisplayName,\E3\83\95\E3\83\AA\E3\82\AC\E3\83\8A (\E8\A1\A8\E7\A4\BA\E5\90\8D)\00(\00\00\00mSDS-PhoneticLastName,\E3\83\95\E3\83\AA\E3\82\AC\E3\83\8A (\E5\A7\93)\00)\00\00\00mSDS-PhoneticFirstName,\E3\83\95\E3\83\AA\E3\82\AC\E3\83\8A (\E5\90\8D)\00\19\00\00\00mobile,\E6\90\BA\E5\B8\AF\E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7\00\1E\00\00\00middleName,\E3\83\9F\E3\83\89\E3\83\AB \E3\83\8D\E3\83\BC\E3\83\A0\00!\00\00\00memberOf,\E6\89\80\E5\B1\9E\E3\81\99\E3\82\8B\E3\82\B0\E3\83\AB\E3\83\BC\E3\83\97\00\0E\00\00\00manager,\E4\B8\8A\E5\8F\B8\00!\00\00\00mail,\E9\9B\BB\E5\AD\90\E3\83\A1\E3\83\BC\E3\83\AB \E3\82\A2\E3\83\89\E3\83\AC\E3\82\B9\00\0E\00\00\00l,\E5\B8\82\E5\8C\BA\E7\94\BA\E6\9D\91\00\17\00\00\00ipPhone,IP \E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7\006\00\00\00internationalISDNNumber,\E5\9B\BD\E9\9A\9B ISDN \E7\95\AA\E5\8F\B7 (\E3\81\9D\E3\81\AE\E4\BB\96)\00\18\00\00\00initials,\E3\82\A4\E3\83\8B\E3\82\B7\E3\83\A3\E3\83\AB\00\1E\00\00\00homePostalAddress,\E8\87\AA\E5\AE\85\E4\BD\8F\E6\89\80\00\1C\00\00\00homePhone,\E8\87\AA\E5\AE\85\E9\9B\BB\E8\A9\B1\E7\95\AA\E5\8F\B7\00 \00\00\00homeDrive,\E3\83\9B\E3\83\BC\E3\83\A0 \E3\83\89\E3\83\A9\E3\82\A4\E3\83\96\00'\00\00\00homeDirectory,\E3\83\9B\E3\83\BC\E3\83\A0 \E3\83\95\E3\82\A9\E3\83\AB\E3\83\80\E3\83\BC\00\0D\00\00\00givenName,\E5\90\8D\00,\00\00\00generationQualifier,\E5\90\8D\E5\89\8D\E3\82\B5\E3\83\95\E3\82\A3\E3\83\83\E3\82\AF\E3\82\B9\00#\00\00\00facsimileTelephoneNumber,FAX \E7\95\AA\E5\8F\B7\00\14\00\00\00employeeID,\E7\A4\BE\E5\93\A1 ID\00\0F\00\00\00division,\E6\9C\AC\E9\83\A8\00\1B\00\00\00distinguishedName,\E8\AD\98\E5\88\A5\E5\90\8D\00\1D\00\00\00directReports,\E7\9B\B4\E6\8E\A5\E5\A0\B1\E5\91\8A\E8\80\85\00\12\00\00\00description,\E8\AA\AC\E6\98\8E\00\11\00\00\00department,\E9\83\A8\E7\BD\B2\00\11\00\00\00company,\E4\BC\9A\E7\A4\BE\E5\90\8D\00\14\00\00\00comment,\E3\82\B3\E3\83\A1\E3\83\B3\E3\83\88\00\06\00\00\00co,\E5\9B\BD\00\0E\00\00\00c,\E5\9B\BD\E3\81\AE\E7\95\A5\E5\90\8D\00\09\00\00\00cn,\E5\90\8D\E5\89\8D\00\1C\00\00\00assistant,\E3\82\A2\E3\82\B7\E3\82\B9\E3\82\BF\E3\83\B3\E3\83\88\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30564-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1661\00"
+data(153) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1661\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=ActiveDirectoryUpdate,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2221\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2221\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2144\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2144\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(112) = "DN=CN=FOREIGNSECURITYPRINCIPAL-DISPLAY,CN=40B,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1833) = "g\19\01&\11\00\00\00CN=foreignSecurityPrincipal-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002948\00uSNChanged\00\01\00\00\00\04\00\00\002948\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00objectGUID\00\01\00\00\00\10\00\00\00\D0+16&\DE\95G\BD\B0\8F#\CBf\94z\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\84\0B\00\00\00\00\00\00\84\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6486-a212-11d0-bcd5-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\17\00\00\00Ulkoinen suojausobjekti\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,Kuvaus\00\07\00\00\00cn,Nimi\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2067\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2067\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=nTDSConnection-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(114) = "DN=CN=SERVICEADMINISTRATIONPOINT-DISPLAY,CN=C0A,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2030) = "g\19\01&\12\00\00\00CN=serviceAdministrationPoint-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\22\00\00\00serviceAdministrationPoint-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002618\00uSNChanged\00\01\00\00\00\04\00\00\002618\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\22\00\00\00serviceAdministrationPoint-Display\00objectGUID\00\01\00\00\00\10\00\00\00\DC\AD\CEPd\95,C\B9+`\08\0Fks\D0\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC:\0A\00\00\00\00\00\00:\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\05\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{c5f1645d-c8c9-11d0-bcdb-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{c5f1645e-c8c9-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\08\00\00\00Servicio\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2943\00"
+data(139) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2943\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(113) = "DN=CN=REMOTESTORAGESERVICEPOINT-DISPLAY,CN=413,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1870) = "g\19\01&\12\00\00\00CN=remoteStorageServicePoint-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002594\00uSNChanged\00\01\00\00\00\04\00\00\002594\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00objectGUID\00\01\00\00\00\10\00\00\00\1CS\B1\84yz\1FI\8B\92\13\13]\13\C66\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\0A\00\00\00\00\00\00\22\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\16\00\00\00Remote Storage-service\00adminContextMenu\00\01\00\00\00\19\00\00\000,&Beheren...,RsAdmin.msc\00attributeDisplayNames\00\01\00\00\00\07\00\00\00cn,Naam\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2866\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2866\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2789\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2789\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=site-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2592\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2592\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3152\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3152\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=lostAndFound-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(25) = "DN=@INDEX:NAME:MSMQ-SEND\00"
+data(142) = "g\19\01&\02\00\00\00@INDEX:NAME:MSMQ-SEND\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00L\00\00\00CN=msmq-Send,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::59pwPa5qFUy6Df5crGRr+w==\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::59pwPa5qFUy6Df5crGRr+w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00T\00\00\00CN=Change-Rid-Master,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3075\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3075\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(80) = "DN=CN=MSMQ-SEND,CN=EXTENDED-RIGHTS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1673) = "g\19\01&\12\00\00\00CN=msmq-Send,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\12\00\00\00controlAccessRight\00cn\00\01\00\00\00\09\00\00\00msmq-Send\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00displayName\00\01\00\00\00\0C\00\00\00Send Message\00uSNCreated\00\01\00\00\00\04\00\00\001603\00uSNChanged\00\01\00\00\00\04\00\00\001603\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\09\00\00\00msmq-Send\00objectGUID\00\01\00\00\00\10\00\00\00\0FY\A3\F0\89\B8\99A\9F\8B\83^Vl\B9\F1\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\0D\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00T\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00U\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00I\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00L\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCC\06\00\00\00\00\00\00C\06\00\00\00\00\00\00\00rightsGuid\00\01\00\00\00$\00\00\0006bd3202-df3e-11d1-9c86-006008764d0e\00appliesTo\00\02\00\00\00$\00\00\0046b27aac-aafa-4ffb-b773-e5bf621ee87b\00$\00\00\009a0dc343-c100-11d1-bbc5-0080c76670c0\00objectCategory\00\01\00\00\00N\00\00\00CN=Control-Access-Right,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00localizationDisplayId\00\01\00\00\00\02\00\00\0044\00validAccesses\00\01\00\00\00\03\00\00\00256\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::UukspiiIgEmlvcwJYyZwag==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::UukspiiIgEmlvcwJYyZwag==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::/KvVJvHzjkqHQe3CWSijLA==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::/KvVJvHzjkqHQe3CWSijLA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(113) = "DN=CN=REMOTESTORAGESERVICEPOINT-DISPLAY,CN=411,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1885) = "g\19\01&\12\00\00\00CN=remoteStorageServicePoint-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003077\00uSNChanged\00\01\00\00\00\04\00\00\003077\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00!\00\00\00remoteStorageServicePoint-Display\00objectGUID\00\01\00\00\00\10\00\00\00\01WG\FA:>6F\81\02\FA 9\08\89\FB\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00&\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\0C\00\00\00\00\00\00\05\0C\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00!\00\00\00\E3\83\AA\E3\83\A2\E3\83\BC\E3\83\88\E8\A8\98\E6\86\B6\E5\9F\9F\E3\82\B5\E3\83\BC\E3\83\93\E3\82\B9\00adminContextMenu\00\01\00\00\00\1B\00\00\000,\E7\AE\A1\E7\90\86(&M)...,RsAdmin.msc\00attributeDisplayNames\00\01\00\00\00\09\00\00\00cn,\E5\90\8D\E5\89\8D\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2976\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2976\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=container-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Dj+XtT5bXkiWI0nunomAcQ==\00"
+data(180) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Dj+XtT5bXkiWI0nunomAcQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2899\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2899\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=PKICERTIFICATETEMPLATE-DISPLAY,CN=816,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2095) = "g\19\01&\14\00\00\00CN=pKICertificateTemplate-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002098\00uSNChanged\00\01\00\00\00\04\00\00\002098\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00objectGUID\00\01\00\00\00\10\00\00\00AP7\91u\15\AAA\80c\A5\F6\09`\99\C9\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC2\08\00\00\00\00\00\002\08\00\00\00\00\00\00\00iconPath\00\01\00\00\00\13\00\00\000,certtmpl.dll,-144\00contextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00classDisplayName\00\01\00\00\00\15\00\00\00Modelo de Certificado\00adminContextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00attributeDisplayNames\00\02\00\00\00\17\00\00\00description,Descri\C3\A7\C3\A3o\00\07\00\00\00cn,Nome\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTCLASS:FOREIGNSECURITYPRINCIPAL\00"
+data(2663) = "g\19\01&\02\00\00\00@INDEX:OBJECTCLASS:FOREIGNSECURITYPRINCIPAL\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\1A\00\00\00b\00\00\00CN=This Organization,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00W\00\00\00CN=Dialup,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=Service,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=Other Organization,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=Local Service,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00V\00\00\00CN=Proxy,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=Remote Interactive Logon,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00U\00\00\00CN=Self,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=Terminal Server User,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00n\00\00\00CN=Enterprise Domain Controllers,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=Network,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=Creator Group,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=Interactive,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=Network Service,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=Owner Rights,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00U\00\00\00CN=IUSR,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=NTLM Authentication,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=Creator Owner,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=Authenticated Users,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=Restricted,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=Digest Authentication,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=Anonymous Logon,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00V\00\00\00CN=Batch,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00W\00\00\00CN=System,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00h\00\00\00CN=SChannel Authentication,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Y\00\00\00CN=Everyone,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::YN8vly3EnU+bJxYb1x+LKA==\00"
+data(174) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::YN8vly3EnU+bJxYb1x+LKA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=DS-Query-Self-Quota,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=INTELLIMIRRORSCP-DISPLAY,CN=804,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1699) = "g\19\01&\10\00\00\00CN=IntellimirrorSCP-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001882\00uSNChanged\00\01\00\00\00\04\00\00\001882\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00objectGUID\00\01\00\00\00\10\00\00\00\DBf\E2\B5\03w?I\82tT\A4Fv\18\A3\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCZ\07\00\00\00\00\00\00Z\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4e40f770-369c-11d0-8922-00a024ab2dbb}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00classDisplayName\00\01\00\00\00\14\00\00\00IntelliMirror \E6\9C\8D\E5\8A\A1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1613\00"
+data(156) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1613\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=Certificate-Enrollment,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::gVMctjcylkySOH2hpnWQ4w==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::gVMctjcylkySOH2hpnWQ4w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=IntellimirrorSCP-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2119\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2119\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=nTDSSettings-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=PKICERTIFICATETEMPLATE-DISPLAY,CN=416,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2095) = "g\19\01&\14\00\00\00CN=pKICertificateTemplate-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001818\00uSNChanged\00\01\00\00\00\04\00\00\001818\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00objectGUID\00\01\00\00\00\10\00\00\00\E8\A7\A9\BE18\CAD\BD\80\A1\D8\F4\DA\0E\BE\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\07\00\00\00\00\00\00\1A\07\00\00\00\00\00\00\00iconPath\00\01\00\00\00\13\00\00\000,certtmpl.dll,-144\00contextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00classDisplayName\00\01\00\00\00\15\00\00\00Modelo de Certificado\00adminContextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00attributeDisplayNames\00\02\00\00\00\17\00\00\00description,Descri\C3\A7\C3\A3o\00\07\00\00\00cn,Nome\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::HHB9dSMr1kK3wZ2F//fIMA==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::HHB9dSMr1kK3wZ2F//fIMA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=nTDSDSA-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2818\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2818\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2621\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2621\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=site-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1961\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1961\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=MSMQMIGRATEDUSER-DISPLAY,CN=413,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1613) = "g\19\01&\10\00\00\00CN=mSMQMigratedUser-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002589\00uSNChanged\00\01\00\00\00\04\00\00\002589\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00objectGUID\00\01\00\00\00\10\00\00\00-\81\00\88\03\04uE\8AS\1B\BA3J\A9p\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0A\00\00\00\00\00\00\1D\0A\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00classDisplayName\00\01\00\00\00\1A\00\00\00Bijgewerkte MSMQ-gebruiker\00adminContextMenu\00\01\00\00\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3104\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3104\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=server-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1884\00"
+data(156) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1884\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2544\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2544\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=queryPolicy-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2467\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2467\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3027\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3027\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=IntellimirrorGroup-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2270\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2270\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=inetOrgPerson-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2170\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2170\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2193\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2193\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=rpcContainer-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=4444C516-F43A-4C12-9C4B-B5C064941D61,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=4444c516-f43a-4c12-9c4b-b5c064941d61,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\004444c516-f43a-4c12-9c4b-b5c064941d61\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001693\00uSNChanged\00\01\00\00\00\04\00\00\001693\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\004444c516-f43a-4c12-9c4b-b5c064941d61\00objectGUID\00\01\00\00\00\10\00\00\003D:P\92\A7\D5C\92y\FB\E3=\C5\15\EA\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9D\06\00\00\00\00\00\00\9D\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=26D9C511-E61A-11D6-9793-00C04F613221,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=26d9c511-e61a-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\0026d9c511-e61a-11d6-9793-00c04f613221\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001686\00uSNChanged\00\01\00\00\00\04\00\00\001686\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\0026d9c511-e61a-11d6-9793-00c04f613221\00objectGUID\00\01\00\00\00\10\00\00\00T\F2}\03e\E9\B4D\80\93\DF\16\F6 7\95\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\06\00\00\00\00\00\00\96\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2892\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2892\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=IntellimirrorSCP-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2928\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2928\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=2A858903-5696-4364-B4E5-4CAC027CA7A6,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=2a858903-5696-4364-b4e5-4cac027ca7a6,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\002a858903-5696-4364-b4e5-4cac027ca7a6\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001704\00uSNChanged\00\01\00\00\00\04\00\00\001704\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\002a858903-5696-4364-b4e5-4cac027ca7a6\00objectGUID\00\01\00\00\00\10\00\00\00\FB\A9\9E\B6\DD\ADfA\AE\09\7FR\150(\CB\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\06\00\00\00\00\00\00\A8\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(41) = "DN=@INDEX:NAME:CERTIFICATION AUTHORITIES\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:NAME:CERTIFICATION AUTHORITIES\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=Certification Authorities,CN=Public Key Services,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(40) = "DN=@INDEX:CN:DS-REPLICATION-GET-CHANGES\00"
+data(174) = "g\19\01&\02\00\00\00@INDEX:CN:DS-REPLICATION-GET-CHANGES\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=DS-Replication-Get-Changes,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2654\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2654\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(98) = "DN=CN=PRINTQUEUE-DISPLAY,CN=407,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2934) = "g\19\01&\13\00\00\00CN=printQueue-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\12\00\00\00printQueue-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002004\00uSNChanged\00\01\00\00\00\04\00\00\002004\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\12\00\00\00printQueue-Display\00objectGUID\00\01\00\00\00\10\00\00\00\A7.\0F\F05\BF1E\B8x\B9\14\F1\E6R:\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D4\07\00\00\00\00\00\00\D4\07\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6493-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f5-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\07\00\00\00Drucker\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\1B\00\00\00\1B\00\00\00versionNumber,Objektversion\00\14\00\00\00url,Webseitenadresse\00\15\00\00\00serverName,Servername\00*\00\00\00printStaplingSupported,Unterst\C3\BCtzt Heften\00\1B\00\00\00printShareName,Freigabename\00%\00\00\00printPagesPerMinute,Seiten pro Minute\00'\00\00\00printRateUnit,Geschwindigkeitseinheiten\00\19\00\00\00printRate,Geschwindigkeit\00\13\00\00\00printOwner,Besitzer\00\22\00\00\00printMemory,Installierter Speicher\00-\00\00\00printMediaSupported,Unterst\C3\BCtzte Papiertypen\00#\00\00\00printMediaReady,Verf\C3\BCgbares Papier\00/\00\00\00printMaxResolutionSupported,Maximale Aufl\C3\B6sung\00\1C\00\00\00printLanguage,Druckersprache\00\10\00\00\00printerName,Name\006\00\00\00printDuplexSupported,Unterst\C3\BCtzt beidseitiges Drucken\00(\00\00\00printColor,Unterst\C3\BCtzt farbiges Drucken\00#\00\00\00printCollate,Unterst\C3\BCtzt Sortieren\00\1E\00\00\00printBinNames,Eingabesch\C3\A4chte\00\12\00\00\00portName,Anschluss\00\18\00\00\00location,Druckerstandort\00\11\00\00\00driverName,Modell\00\15\00\00\00description,Kommentar\00\13\00\00\00contactName,Kontakt\00\19\00\00\00assetNumber,Ger\C3\A4tenummer\00\14\00\00\00uNCName,Netzwerkname\00\18\00\00\00cn,Verzeichnisdienstname\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(90) = "DN=CN=MIGRATE-SID-HISTORY,CN=EXTENDED-RIGHTS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1669) = "g\19\01&\12\00\00\00CN=Migrate-SID-History,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\12\00\00\00controlAccessRight\00cn\00\01\00\00\00\13\00\00\00Migrate-SID-History\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00displayName\00\01\00\00\00\13\00\00\00Migrate SID History\00uSNCreated\00\01\00\00\00\04\00\00\001625\00uSNChanged\00\01\00\00\00\04\00\00\001625\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00Migrate-SID-History\00objectGUID\00\01\00\00\00\10\00\00\00\E8\86;\F2\0D\8AsH\BF\86\AF\D5\09`\F3\12\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\0D\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00T\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00U\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00I\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00L\05\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\06\00\00\00\00\00\00Y\06\00\00\00\00\00\00\00rightsGuid\00\01\00\00\00$\00\00\00BA33815A-4F93-4c76-87F3-57574BFF8109\00appliesTo\00\01\00\00\00$\00\00\0019195a5b-6da0-11d0-afd3-00c04fd930c9\00objectCategory\00\01\00\00\00N\00\00\00CN=Control-Access-Right,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00localizationDisplayId\00\01\00\00\00\02\00\00\0063\00validAccesses\00\01\00\00\00\03\00\00\00256\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2577\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2577\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3137\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3137\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::6d/G+qBfV0i3ave7mVGJPQ==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::6d/G+qBfV0i3ave7mVGJPQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(40) = "DN=@INDEX:CN:NTFRSSUBSCRIPTIONS-DISPLAY\00"
+data(2751) = "g\19\01&\02\00\00\00@INDEX:CN:NTFRSSUBSCRIPTIONS-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::fEZVWZQMIkeJ7qxamIK4GQ==\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::fEZVWZQMIkeJ7qxamIK4GQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(17) = "DN=@INDEX:CN:CDP\00"
+data(144) = "g\19\01&\02\00\00\00@INDEX:CN:CDP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=CDP,CN=Public Key Services,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=EDA27B47-E610-11D6-9793-00C04F613221,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=eda27b47-e610-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\00eda27b47-e610-11d6-9793-00c04f613221\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001681\00uSNChanged\00\01\00\00\00\04\00\00\001681\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\00eda27b47-e610-11d6-9793-00c04f613221\00objectGUID\00\01\00\00\00\10\00\00\00W\D2\18A\B2GK@\86Er\E4\F0\A2\9B\8E\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\91\06\00\00\00\00\00\00\91\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:CN:DEE21A17-4E8E-4F40-A58C-C0C009B685A7\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:DEE21A17-4E8E-4F40-A58C-C0C009B685A7\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=dee21a17-4e8e-4f40-a58c-c0c009b685a7,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::wKs1qV4F9Ue8RcVZjrfZKg==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::wKs1qV4F9Ue8RcVZjrfZKg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::O3+E8YeVFkWFfTQZnkZ34Q==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::O3+E8YeVFkWFfTQZnkZ34Q==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=default-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::CLIQ7spyoUKOEWjDdi3Bfw==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::CLIQ7spyoUKOEWjDdi3Bfw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTDSService-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::18jTeoOoZkOB0ABqSKMj4w==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::18jTeoOoZkOB0ABqSKMj4w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::if5wyte3ckWpphKy7Yc5sw==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::if5wyte3ckWpphKy7Yc5sw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::1Kj2QuPlfkKOAKLJOl9ISQ==\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::1Kj2QuPlfkKOAKLJOl9ISQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=THIS ORGANIZATION,CN=WELLKNOWN SECURITY PRINCIPALS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1802) = "g\19\01&\0E\00\00\00CN=This Organization,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\18\00\00\00foreignSecurityPrincipal\00cn\00\01\00\00\00\11\00\00\00This Organization\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171917.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171917.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003377\00uSNChanged\00\01\00\00\00\04\00\00\003377\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\CC\02\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\80\02\12\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\18\00\FF\01\0F\00\01\02\00\00\00\00\00\05 \00\00\00$\02\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00T\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00V\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B2\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\00\00\14\00\00\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00B/\BAY\A2y\D0\11\90 \00\C0O\C2\D3\CF\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00T\01\8D\E4\F8\BC\D1\11\87\02\00\C0O\B9`P\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\01\00\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00This Organization\00objectGUID\00\01\00\00\00\10\00\00\00S\BF\F2P\0F\A8\9BL\A8\D5l\A0\09-\FD\85\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\01\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\02\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\19\01\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\01\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\92\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\03\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC1\0D\00\00\00\00\00\001\0D\00\00\00\00\00\00\00objectSid\00\01\00\00\00\0C\00\00\00\01\01\00\00\00\00\00\05\0F\00\00\00\00objectCategory\00\01\00\00\00T\00\00\00CN=Foreign-Security-Principal,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::7/nb6nkYsEmLygien17ntA==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::7/nb6nkYsEmLygien17ntA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSSubscriber-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::DqpLUEDhPEuB3lZQF6bLrQ==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::DqpLUEDhPEuB3lZQF6bLrQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=Terminal-Server-License-Server,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::oVoMtiU0akqVLqFsAdx+6A==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::oVoMtiU0akqVLqFsAdx+6A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=default-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=CONTAINER-DISPLAY,CN=407,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2140) = "g\19\01&\13\00\00\00CN=container-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00container-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002014\00uSNChanged\00\01\00\00\00\04\00\00\002014\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00container-Display\00objectGUID\00\01\00\00\00\10\00\00\00<\02B\05]\0EOA\AB\13\FD\EC\AAS\10;\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DE\07\00\00\00\00\00\00\DE\07\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{5a96f2d8-736e-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\09\00\00\00Container\00adminContextMenu\00\04\00\00\00(\00\00\004,{AB790AA1-CDC1-478a-9351-B2E05CFCAD09}\00(\00\00\003,{EEBD2F15-87EE-4F93-856F-6AD7E31787B3}\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\02\00\00\00\18\00\00\00description,Beschreibung\00\07\00\00\00cn,Name\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1936\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1936\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-UI-Default-Settings,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1859\00"
+data(168) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1859\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2419\00"
+data(168) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2419\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::X1/E25+/JEKpct5G+wl7Ig==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::X1/E25+/JEKpct5G+wl7Ig==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::SjZdWNbMokuLBp3d1W/ofg==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::SjZdWNbMokuLBp3d1W/ofg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTDSService-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2222\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2222\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2145\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2145\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2068\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2068\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=subnet-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::NiW65e7BRkmal1njoipu8A==\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::NiW65e7BRkmal1njoipu8A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(20) = "DN=@INDEX:CN:DIALUP\00"
+data(148) = "g\19\01&\02\00\00\00@INDEX:CN:DIALUP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00W\00\00\00CN=Dialup,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::NLfma3ZlN0qVnzlvidAHdg==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::NLfma3ZlN0qVnzlvidAHdg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::IpmSjYikY0+Jq+EcBY9mPw==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::IpmSjYikY0+Jq+EcBY9mPw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTFRSMember-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2570\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2570\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=nTDSDSA-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2493\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2493\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=lostAndFound-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2606\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2606\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=inetOrgPerson-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2529\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2529\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=rpcContainer-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=NTFRSSUBSCRIPTIONS-DISPLAY,CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1701) = "g\19\01&\10\00\00\00CN=nTFRSSubscriptions-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00nTFRSSubscriptions-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002752\00uSNChanged\00\01\00\00\00\04\00\00\002752\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00nTFRSSubscriptions-Display\00objectGUID\00\01\00\00\00\10\00\00\00\0AZj\91c\CD\F7D\88\09\B7\D8H^$\AA\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0A\00\00\00\00\00\00\C0\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30560-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\12\00\00\00Sottoscrizioni FRS\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Qsj1g7bXG0iUnBr50EbQxg==\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Qsj1g7bXG0iUnBr50EbQxg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(59) = "DN=@INDEX:DISPLAYNAME:MONITOR ACTIVE DIRECTORY REPLICATION\00"
+data(198) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:MONITOR ACTIVE DIRECTORY REPLICATION\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-Replication-Monitor-Topology,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2178\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2178\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=nTDSDSA-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::X2SKfFS8HUydbbQ/acoQlA==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::X2SKfFS8HUydbbQ/acoQlA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=organizationalUnit-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=MSMQMIGRATEDUSER-DISPLAY,CN=412,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1620) = "g\19\01&\10\00\00\00CN=mSMQMigratedUser-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001973\00uSNChanged\00\01\00\00\00\04\00\00\001973\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00objectGUID\00\01\00\00\00\10\00\00\00\87\1D\8C\7Ff\FB\E6D\86\ED4#\88\97A\A0\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\07\00\00\00\00\00\00\B5\07\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00classDisplayName\00\01\00\00\00!\00\00\00MSMQ \EC\97\85\EA\B7\B8\EB\A0\88\EC\9D\B4\EB\93\9C\ED\95\9C \EC\82\AC\EC\9A\A9\EC\9E\90\00adminContextMenu\00\01\00\00\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2954\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2954\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-UI-Default-Settings,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2877\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2877\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=subnetContainer-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2680\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2680\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(27) = "DN=@INDEX:NAME:NETSERVICES\00"
+data(139) = "g\19\01&\02\00\00\00@INDEX:NAME:NETSERVICES\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00G\00\00\00CN=NetServices,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3163\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3163\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3086\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3086\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=msCOM-PartitionSet-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(43) = "DN=@INDEX:DISPLAYNAME:CHANGE SCHEMA MASTER\00"
+data(171) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:CHANGE SCHEMA MASTER\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00W\00\00\00CN=Change-Schema-Master,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::U84mZrjrOU2qCttUQ4iN3A==\00"
+data(193) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::U84mZrjrOU2qCttUQ4iN3A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1614\00"
+data(149) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1614\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00R\00\00\00CN=Self-Membership,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::7nUjxnEJuEC/24kIoYW3vA==\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::7nUjxnEJuEC/24kIoYW3vA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=server-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(42) = "DN=@INDEX:DISPLAYNAME:MS-TS-GATEWAYACCESS\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:MS-TS-GATEWAYACCESS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=MS-TS-GatewayAccess,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(18) = "DN=@INDEX:CN:RRAS\00"
+data(123) = "g\19\01&\02\00\00\00@INDEX:CN:RRAS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00@\00\00\00CN=RRAS,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::YbRNHP1kCUqxtP49FTNf5Q==\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::YbRNHP1kCUqxtP49FTNf5Q==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=subnet-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::LH+8xc8XoUeqhPL6ETJTQQ==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::LH+8xc8XoUeqhPL6ETJTQQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=domainPolicy-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(101) = "DN=CN=NTFRSSETTINGS-DISPLAY,CN=408,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1690) = "g\19\01&\10\00\00\00CN=nTFRSSettings-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\15\00\00\00nTFRSSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002288\00uSNChanged\00\01\00\00\00\04\00\00\002288\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\15\00\00\00nTFRSSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00\D2\81=\E1?a\C4M\AE\F8\BA\F6\C0\F9\8BT\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F0\08\00\00\00\00\00\00\F0\08\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd68-c63b-11d0-b94d-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\16\00\00\00\CE\A1\CF\85\CE\B8\CE\BC\CE\AF\CF\83\CE\B5\CE\B9\CF\82 FRS\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=CONTACT-DISPLAY,CN=804,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(3792) = "g\19\01&\14\00\00\00CN=contact-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00contact-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001886\00uSNChanged\00\01\00\00\00\04\00\00\001886\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00contact-Display\00objectGUID\00\01\00\00\00\10\00\00\00XY\DC\1C\85/4@\B5\D3\EA\E9\ACB\96\D0\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00&\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC^\07\00\00\00\00\00\00^\07\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\005,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{c5f1645c-c8c9-11d0-bcdb-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f0-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\09\00\00\00\E8\81\94\E7\B3\BB\E4\BA\BA\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\007\00\00\00\18\00\00\00wWWHomePage,\E7\BD\91\E9\A1\B5\E5\9C\B0\E5\9D\80\00\18\00\00\00url,\E7\BD\91\E9\A1\B5\E5\9C\B0\E5\9D\80(\E5\85\B6\E4\BB\96)\00\0C\00\00\00title,\E8\81\8C\E5\8A\A1\00 \00\00\00telexNumber,\E7\94\B5\E6\8A\A5\E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\00\1C\00\00\00telephoneNumber,\E7\94\B5\E8\AF\9D\E5\8F\B7\E7\A0\81\00\1A\00\00\00streetAddress,\E8\A1\97\E9\81\93\E5\9C\B0\E5\9D\80\00\1A\00\00\00st,\E7\9C\81/\E7\9B\B4\E8\BE\96\E5\B8\82/\E8\87\AA\E6\B2\BB\E5\8C\BA\00\06\00\00\00sn,\E5\A7\93\00\1F\00\00\00primaryTelexNumber,\E7\94\B5\E6\8A\A5\E5\8F\B7\E7\A0\81\001\00\00\00primaryInternationalISDNNumber,\E5\9B\BD\E9\99\85 ISDN \E5\8F\B7\E7\A0\81\00\14\00\00\00postOfficeBox,\E9\82\AE\E7\AE\B1\00\17\00\00\00postalCode,\E9\82\AE\E6\94\BF\E7\BC\96\E7\A0\81\00*\00\00\00physicalDeliveryOfficeName,\E5\8A\9E\E5\85\AC\E5\AE\A4\E4\BD\8D\E7\BD\AE\00\14\00\00\00personalTitle,\E5\A4\B4\E8\A1\94\00\12\00\00\00pager,\E5\91\BC\E6\9C\BA\E5\8F\B7\E7\A0\81\00#\00\00\00otherTelephone,\E7\94\B5\E8\AF\9D\E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\00\1F\00\00\00otherPager,\E5\91\BC\E6\9C\BA\E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\00&\00\00\00otherMobile,\E7\A7\BB\E5\8A\A8\E7\94\B5\E8\AF\9D\E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\00'\00\00\00otherMailbox,\E7\94\B5\E5\AD\90\E9\82\AE\E4\BB\B6\E5\9C\B0\E5\9D\80(\E5\85\B6\E4\BB\96)\00$\00\00\00otherIpPhone,IP \E7\94\B5\E8\AF\9D\E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\00)\00\00\00otherHomePhone,\E5\AE\B6\E5\BA\AD\E7\94\B5\E8\AF\9D\E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\002\00\00\00otherFacsimileTelephoneNumber,\E4\BC\A0\E7\9C\9F\E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\00$\00\00\00mSDS-PhoneticDepartment,\E6\B3\A8\E9\9F\B3\E9\83\A8\E9\97\A8\00+\00\00\00mSDS-PhoneticCompanyName,\E6\8B\BC\E9\9F\B3\E5\85\AC\E5\8F\B8\E5\90\8D\E7\A7\B0\00+\00\00\00mSDS-PhoneticDisplayName,\E6\8B\BC\E9\9F\B3\E6\98\BE\E7\A4\BA\E5\90\8D\E7\A7\B0\00\1F\00\00\00mSDS-PhoneticLastName,\E6\8B\BC\E9\9F\B3\E5\A7\93\00 \00\00\00mSDS-PhoneticFirstName,\E6\8B\BC\E9\9F\B3\E5\90\8D\00\19\00\00\00mobile,\E7\A7\BB\E5\8A\A8\E7\94\B5\E8\AF\9D\E5\8F\B7\E7\A0\81\00\14\00\00\00middleName,\E4\B8\AD\E9\97\B4\E5\90\8D\00\1B\00\00\00memberOf,\E6\88\90\E5\91\98\E8\BA\AB\E4\BB\BD\E5\B1\9E\E4\BA\8E\00\0E\00\00\00manager,\E7\BB\8F\E7\90\86\00\17\00\00\00mail,\E7\94\B5\E5\AD\90\E9\82\AE\E4\BB\B6\E5\9C\B0\E5\9D\80\00\09\00\00\00l,\E5\8E\BF/\E5\B8\82\00\17\00\00\00ipPhone,IP \E7\94\B5\E8\AF\9D\E5\8F\B7\E7\A0\81\002\00\00\00internationalISDNNumber,\E5\9B\BD\E9\99\85 ISDN \E5\8F\B7\E7\A0\81(\E5\85\B6\E4\BB\96)\00\0B\00\00\00info,\E8\AF\B4\E6\98\8E\00\15\00\00\00initials,\E8\8B\B1\E6\96\87\E7\BC\A9\E5\86\99\00\1E\00\00\00homePostalAddress,\E5\AE\B6\E5\BA\AD\E5\9C\B0\E5\9D\80\00\16\00\00\00homePhone,\E5\AE\B6\E5\BA\AD\E7\94\B5\E8\AF\9D\00\0D\00\00\00givenName,\E5\90\8D\00 \00\00\00generationQualifier,\E4\B8\96\E8\A2\AD\E7\A7\B0\E8\B0\93\00%\00\00\00facsimileTelephoneNumber,\E4\BC\A0\E7\9C\9F\E5\8F\B7\E7\A0\81\00\17\00\00\00employeeID,\E8\81\8C\E5\91\98\E7\BC\96\E5\8F\B7\00\0F\00\00\00division,\E5\88\86\E9\83\A8\00!\00\00\00distinguishedName,\E5\8F\AF\E5\88\86\E8\BE\A8\E5\90\8D\E7\A7\B0\00\18\00\00\00displayName,\E6\98\BE\E7\A4\BA\E5\90\8D\E7\A7\B0\00\1A\00\00\00directReports,\E7\9B\B4\E6\8E\A5\E4\B8\8B\E5\B1\9E\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\11\00\00\00department,\E9\83\A8\E9\97\A8\00\0E\00\00\00company,\E5\85\AC\E5\8F\B8\00\0E\00\00\00comment,\E5\A4\87\E6\B3\A8\00\09\00\00\00cn,\E5\90\8D\E7\A7\B0\00\11\00\00\00co,\E5\9B\BD\E5\AE\B6(\E5\9C\B0\E5\8C\BA)\00\16\00\00\00c,\E5\9B\BD\E5\AE\B6(\E5\9C\B0\E5\8C\BA)\E7\BC\A9\E5\86\99\00\10\00\00\00assistant,\E5\8A\A9\E6\89\8B\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::vMNGSjgSjUumLa/6AVZn5Q==\00"
+data(198) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::vMNGSjgSjUumLa/6AVZn5Q==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1962\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1962\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=siteLinkBridge-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1885\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1885\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:CN:26D9C510-E61A-11D6-9793-00C04F613221\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:26D9C510-E61A-11D6-9793-00C04F613221\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=26d9c510-e61a-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2171\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2171\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=computer-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2094\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2094\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2207\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2207\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTDSService-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(31) = "DN=@INDEX:CN:DIRECTORY SERVICE\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:CN:DIRECTORY SERVICE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(93) = "DN=CN=GROUP-DISPLAY,CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2554) = "g\19\01&\14\00\00\00CN=group-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0D\00\00\00group-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003030\00uSNChanged\00\01\00\00\00\04\00\00\003030\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0D\00\00\00group-Display\00objectGUID\00\01\00\00\00\10\00\00\00z\EA\CD\0D$XmA\92\17a1\19\E230\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00&\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D6\0B\00\00\00\00\00\00\D6\0B\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\06\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{9a899a50-f96b-11d2-ac78-0008c7726cf7}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\002,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6489-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ee-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\04\00\00\00Grup\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\0D\00\00\00\1F\00\00\00wWWHomePage,Web Sayfas\C4\B1 Adresi\00$\00\00\00url,Web Sayfas\C4\B1 Adresi (Di\C4\9Ferleri)\00/\00\00\00samAccountName,Grup ad\C4\B1 (Windows 2000 \C3\B6ncesi)\00*\00\00\00physicalDeliveryOfficeName,\C4\B0\C5\9Fyeri Konumu\00\0B\00\00\00info,Notlar\00-\00\00\00mSDS-PhoneticDisplayName,Fonetik G\C3\B6r\C3\BCnen Ad\00\0E\00\00\00member,\C3\9Cyeler\00\12\00\00\00managedBy,Y\C3\B6neten\00\08\00\00\00l,\C5\9Eehir\00!\00\00\00distinguishedName,Ay\C4\B1rt Edici Ad\00\16\00\00\00description,A\C3\A7\C4\B1klama\00\14\00\00\00c,\C3\9Clke K\C4\B1saltmas\C4\B1\00\07\00\00\00cn,Ad\C4\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::nXmy9wZmnkK2S779okEp/g==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::nXmy9wZmnkK2S779okEp/g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTDSService-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2906\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2906\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::P/pS8JRqFUeXK+wVwpMCHg==\00"
+data(203) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::P/pS8JRqFUeXK+wVwpMCHg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=8f86b825-c322-4101-adc4-579f12d445db,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::VPJ9A2XptESAk98W9iA3lQ==\00"
+data(203) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::VPJ9A2XptESAk98W9iA3lQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=26d9c511-e61a-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2929\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2929\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::VS6YgEvCdU2hXuvufcTU9w==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::VS6YgEvCdU2hXuvufcTU9w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::vNsCk17pQUuMgouqY1jFhg==\00"
+data(152) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::vNsCk17pQUuMgouqY1jFhg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00@\00\00\00CN=RRAS,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2632\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2632\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=default-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1995\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1995\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2555\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2555\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=NTDSDSA-DISPLAY,CN=415,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1678) = "g\19\01&\10\00\00\00CN=nTDSDSA-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00nTDSDSA-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002908\00uSNChanged\00\01\00\00\00\04\00\00\002908\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00nTDSDSA-Display\00objectGUID\00\01\00\00\00\10\00\00\00_\9B_+#\C4\B1I\94oH\10bQpk\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\5C\0B\00\00\00\00\00\00\5C\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{717EF4FC-AC8D-11D0-B945-00C04FD8D5B0}\00classDisplayName\00\01\00\00\00\1C\00\00\00Ustawienia kontrolera domeny\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3138\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3138\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2478\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2478\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2281\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2281\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=LOSTANDFOUND-DISPLAY,CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2063) = "g\19\01&\13\00\00\00CN=lostAndFound-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00lostAndFound-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003024\00uSNChanged\00\01\00\00\00\04\00\00\003024\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00lostAndFound-Display\00objectGUID\00\01\00\00\00\10\00\00\00\CD\1CQ\15\9D\DF\93@\9A]\A9*\CB\BD \D2\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\97\06\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D0\0B\00\00\00\00\00\00\D0\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00adminContextMenu\00\01\00\00\00(\00\00\000,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\16\00\00\00description,A\C3\A7\C4\B1klama\00\07\00\00\00cn,Ad\C4\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00extraColumns\00\01\00\00\00.\00\00\00lastKnownParent,Bilinen Son \C3\9Cst \C3\96\C4\9Fe,1,300,0\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30563-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(100) = "DN=CN=DOMAINPOLICY-DISPLAY,CN=415,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1993) = "g\19\01&\12\00\00\00CN=domainPolicy-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00domainPolicy-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002897\00uSNChanged\00\01\00\00\00\04\00\00\002897\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00domainPolicy-Display\00objectGUID\00\01\00\00\00\10\00\00\00~D\DBD\F8\E4QG\B2\C1\93u\9D\EF\B8r\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCQ\0B\00\00\00\00\00\00Q\0B\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\05\00\00\00(\00\00\005,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\002,{AAD30A04-E1D0-11d0-B859-00A024CDD4DE}\00(\00\00\001,{6dfe648e-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f1-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0D\00\00\00Zasady domeny\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(35) = "DN=@INDEX:NAME:QUERYPOLICY-DISPLAY\00"
+data(2571) = "g\19\01&\02\00\00\00@INDEX:NAME:QUERYPOLICY-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00_\00\00\00CN=queryPolicy-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(32) = "DN=@INDEX:NAME:SITELINK-DISPLAY\00"
+data(2493) = "g\19\01&\02\00\00\00@INDEX:NAME:SITELINK-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00\5C\00\00\00CN=siteLink-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(94) = "DN=CN=ACTIVEDIRECTORYRODCUPDATE,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1282) = "g\19\01&\0E\00\00\00CN=ActiveDirectoryRodcUpdate,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\19\00\00\00ActiveDirectoryRodcUpdate\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001660\00uSNChanged\00\01\00\00\00\04\00\00\001660\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\19\00\00\00ActiveDirectoryRodcUpdate\00objectGUID\00\01\00\00\00\10\00\00\00\BCY@\B8\8E>]G\8A\DB\9E\5Cwx\E6?\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\91\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC|\06\00\00\00\00\00\00|\06\00\00\00\00\00\00\00revision\00\01\00\00\00\01\00\00\005\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=CCFAE63A-7FB5-454C-83AB-0E8E1214974E,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=ccfae63a-7fb5-454c-83ab-0e8e1214974e,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\00ccfae63a-7fb5-454c-83ab-0e8e1214974e\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001690\00uSNChanged\00\01\00\00\00\04\00\00\001690\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\00ccfae63a-7fb5-454c-83ab-0e8e1214974e\00objectGUID\00\01\00\00\00\10\00\00\00\8Fd\E0G+\8D\9EK\930)\84\13D\11&\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9A\06\00\00\00\00\00\00\9A\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(96) = "DN=CN=SITELINK-DISPLAY,CN=406,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1669) = "g\19\01&\10\00\00\00CN=siteLink-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\10\00\00\00siteLink-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003124\00uSNChanged\00\01\00\00\00\04\00\00\003124\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\10\00\00\00siteLink-Display\00objectGUID\00\01\00\00\00\10\00\00\00\12\CA\12Jt\E6\E2L\98\CE\C8\8DG\5C*z\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC4\0C\00\00\00\00\00\004\0C\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30561-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\10\00\00\00Link til omr\C3\A5de\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=NTDSDSA-DISPLAY,CN=405,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1677) = "g\19\01&\10\00\00\00CN=nTDSDSA-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00nTDSDSA-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002794\00uSNChanged\00\01\00\00\00\04\00\00\002794\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00nTDSDSA-Display\00objectGUID\00\01\00\00\00\10\00\00\00\7F\F5\0FH\1B;\8AM\85\86,0s\ED\D1/\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0A\00\00\00\00\00\00\EA\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{717EF4FC-AC8D-11D0-B945-00C04FD8D5B0}\00classDisplayName\00\01\00\00\00\1B\00\00\00Nastaven\C3\AD \C5\99adi\C4\8De dom\C3\A9ny\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:OBJECTCLASS:INTERSITETRANSPORTCONTAINER\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:OBJECTCLASS:INTERSITETRANSPORTCONTAINER\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00N\00\00\00CN=Inter-Site Transports,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=MSMQENTERPRISESETTINGS-DISPLAY,CN=413,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1794) = "g\19\01&\11\00\00\00CN=mSMQEnterpriseSettings-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00mSMQEnterpriseSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002588\00uSNChanged\00\01\00\00\00\04\00\00\002588\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00mSMQEnterpriseSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00u\D6\E9;uj5M\92r\BEND\EA\C9r\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0A\00\00\00\00\00\00\1C\0A\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-253\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{2E4B37AB-CC8B-11D1-9C85-006008764D0E}\00classDisplayName\00\01\00\00\00\10\00\00\00MSMQ-onderneming\00adminContextMenu\00\01\00\00\00(\00\00\001,{2E4B37AB-CC8B-11D1-9C85-006008764D0E}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::TNlPIl7oVkWdODVJAnU23Q==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::TNlPIl7oVkWdODVJAnU23Q==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=organizationalUnit-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1914\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1914\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1837\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1837\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=site-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::H6DmgpJ8Aky/HkU7bAEGdQ==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::H6DmgpJ8Aky/HkU7bAEGdQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTFRSMember-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(36) = "DN=@INDEX:CN:SITESCONTAINER-DISPLAY\00"
+data(2647) = "g\19\01&\02\00\00\00@INDEX:CN:SITESCONTAINER-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00b\00\00\00CN=sitesContainer-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=MSMQMIGRATEDUSER-DISPLAY,CN=C0A,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1614) = "g\19\01&\10\00\00\00CN=mSMQMigratedUser-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002645\00uSNChanged\00\01\00\00\00\04\00\00\002645\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00objectGUID\00\01\00\00\00\10\00\00\00\FD\97]\AC1\C9\F7@\99\D8\8D\1A\1A\CC\B7\0C\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCU\0A\00\00\00\00\00\00U\0A\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00classDisplayName\00\01\00\00\00\1B\00\00\00Usuario actualizado de MSMQ\00adminContextMenu\00\01\00\00\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1640\00"
+data(149) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1640\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00R\00\00\00CN=Domain-Password,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2200\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2200\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(19) = "DN=@INDEX:NAME:41F\00"
+data(132) = "g\19\01&\02\00\00\00@INDEX:NAME:41F\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2123\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2123\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=nTDSConnection-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=MSCOM-PARTITIONSET-DISPLAY,CN=804,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1519) = "g\19\01&\0F\00\00\00CN=msCOM-PartitionSet-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00msCOM-PartitionSet-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001931\00uSNChanged\00\01\00\00\00\04\00\00\001931\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00msCOM-PartitionSet-Display\00objectGUID\00\01\00\00\00\10\00\00\00h\C9\0A%h\F6\E2I\83\90\B8\FF\02a\B1?\00replPropertyMetaData\00\01\00\00\00\F0\01\00\00\01\00\00\00\00\00\00\00\0A\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8B\07\00\00\00\00\00\00\8B\07\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{9305969B-F45F-47E5-A954-6EA879E874CC}\00adminContextMenu\00\01\00\00\00(\00\00\001,{EEBD2F15-87EE-4F93-856F-6AD7E31787B3}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(17) = "DN=@INDEX:CN:40E\00"
+data(130) = "g\19\01&\02\00\00\00@INDEX:CN:40E\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=DOMAINPOLICY-DISPLAY,CN=405,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1995) = "g\19\01&\12\00\00\00CN=domainPolicy-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00domainPolicy-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002783\00uSNChanged\00\01\00\00\00\04\00\00\002783\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00domainPolicy-Display\00objectGUID\00\01\00\00\00\10\00\00\00\8D\D4\0Fk\F2\E2\0AB\87\83\E6\F2>\10\F5\C3\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\0A\00\00\00\00\00\00\DF\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\05\00\00\00(\00\00\005,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\002,{AAD30A04-E1D0-11d0-B859-00A024CDD4DE}\00(\00\00\001,{6dfe648e-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f1-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0F\00\00\00Z\C3\A1sady dom\C3\A9ny\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1947\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1947\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=computer-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2507\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2507\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=computer-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::auFf4GN1zUKwsogMMGhjBg==\00"
+data(170) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::auFf4GN1zUKwsogMMGhjBg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00R\00\00\00CN=Domain-Password,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1750\00"
+data(153) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1750\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=IdentityDictionary,CN=RRAS,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2310\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2310\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1673\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1673\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=39902c52-ef24-4b4b-8033-2c9dfdd173a2,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2233\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2233\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1596\00"
+data(152) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1596\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00U\00\00\00CN=Public-Information,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2156\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2156\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=msCOM-Partition-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2079\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2079\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSSubscriber-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::gp8iSGvvD0upZZ4VuIh7pw==\00"
+data(180) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::gp8iSGvvD0upZZ4VuIh7pw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=computer-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(76) = "DN=CN=412,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1153) = "g\19\01&\0D\00\00\00CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\03\00\00\00412\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001935\00uSNChanged\00\01\00\00\00\04\00\00\001935\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\03\00\00\00412\00objectGUID\00\01\00\00\00\10\00\00\00{\84\17\D2B#4I\ABp\B0n\EDa\AC\9E\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8F\07\00\00\00\00\00\00\8F\07\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::HN4nAZpuE0GiSu2KFdgAtw==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::HN4nAZpuE0GiSu2KFdgAtw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2955\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2955\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=IntellimirrorGroup-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2878\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2878\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2681\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2681\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=DS-UI-DEFAULT-SETTINGS,CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1680) = "g\19\01&\10\00\00\00CN=DS-UI-Default-Settings,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\0C\00\00\00dSUISettings\00cn\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002720\00uSNChanged\00\01\00\00\00\04\00\00\002720\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00objectGUID\00\01\00\00\00\10\00\00\00\97KP\93\C4\DA\F7N\AF\CFl\00\FB\FB\09\90\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00?\05\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\99\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\A7\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A0\0A\00\00\00\00\00\00\A0\0A\00\00\00\00\00\00\00objectCategory\00\01\00\00\00H\00\00\00CN=DS-UI-Settings,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00dSUIAdminNotification\00\02\00\00\00(\00\00\002,{a00e1768-4a9b-4d97-afc6-99d329f605f2}\00(\00\00\001,{E62F8206-B71C-11D1-808D-00A024C48131}\00msDS-Non-Security-Group-Extra-Classes\00\02\00\00\00\13\00\00\00mSMQCustomRecipient\00\09\00\00\00mSMQQueue\00msDS-FilterContainers\00\05\00\00\00\08\00\00\00dns-Zone\00\09\00\00\00Container\00\0E\00\00\00Lost-And-Found\00\0E\00\00\00Builtin-Domain\00\13\00\00\00Organizational-Unit\00"
+}
+{
+key(100) = "DN=CN=RPCCONTAINER-DISPLAY,CN=40D,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1903) = "g\19\01&\12\00\00\00CN=rpcContainer-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00rpcContainer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002137\00uSNChanged\00\01\00\00\00\04\00\00\002137\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00rpcContainer-Display\00objectGUID\00\01\00\00\00\10\00\00\00G\22T\18\AC\BE\D1E\97}\099\07V\8DO\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCY\08\00\00\00\00\00\00Y\08\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30572-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\10\00\00\00\D7\A9\D7\99\D7\A8\D7\95\D7\AA\D7\99 RPC\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\16\00\00\00description,\D7\AA\D7\99\D7\90\D7\95\D7\A8\00\07\00\00\00cn,\D7\A9\D7\9D\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3164\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3164\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3087\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3087\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=msCOM-Partition-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::I8zZ1xxd7kihfhSI1k1rAw==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::I8zZ1xxd7kihfhSI1k1rAw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=domainPolicy-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::pwWGeKUiG0yDRO/MbLHskw==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::pwWGeKUiG0yDRO/MbLHskw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=subnetContainer-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=9FEA28FF-387F-4D57-866D-3893C50F373F,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=9fea28ff-387f-4d57-866d-3893c50f373f,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\009fea28ff-387f-4d57-866d-3893c50f373f\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001719\00uSNChanged\00\01\00\00\00\04\00\00\001719\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\009fea28ff-387f-4d57-866d-3893c50f373f\00objectGUID\00\01\00\00\00\10\00\00\00\A6Z\E9\F8\98\D1\DAE\881\81%X\CF;\0A\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\06\00\00\00\00\00\00\B7\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(76) = "DN=CN=C0A,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1153) = "g\19\01&\0D\00\00\00CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\03\00\00\00C0A\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002607\00uSNChanged\00\01\00\00\00\04\00\00\002607\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\03\00\00\00C0A\00objectGUID\00\01\00\00\00\10\00\00\00.\D8\BB7\A2FdC\AE\FD\97\82W\01\D9H\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC/\0A\00\00\00\00\00\00/\0A\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::8tT2a3hQGUeDW66Rp/en1g==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::8tT2a3hQGUeDW66Rp/en1g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2988\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2988\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::GraaRbOQYU212DlFjq/ivw==\00"
+data(193) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::GraaRbOQYU212DlFjq/ivw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=licensingSiteSettings-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3351\00"
+data(144) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3351\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00M\00\00\00CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(20) = "DN=@INDEX:NAME:SELF\00"
+data(146) = "g\19\01&\02\00\00\00@INDEX:NAME:SELF\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00U\00\00\00CN=Self,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::cKtPpFcTP0GkFdtJKnUiCw==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::cKtPpFcTP0GkFdtJKnUiCw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=sitesContainer-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1702\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1702\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=0fc5a978-0059-4b0a-9dc2-9896e8e389a1,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(52) = "DN=@INDEX:NAME:C03B1F37-C240-4910-93C8-1544A452B4B5\00"
+data(208) = "g\19\01&\02\00\00\00@INDEX:NAME:C03B1F37-C240-4910-93C8-1544A452B4B5\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=c03b1f37-c240-4910-93c8-1544a452b4b5,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1625\00"
+data(153) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1625\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=Migrate-SID-History,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2108\00"
+data(156) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2108\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::KFgB574ZY0qjzDOqyZ0e3g==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::KFgB574ZY0qjzDOqyZ0e3g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTFRSMember-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2907\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2907\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(23) = "DN=@INDEX:NAME:SEND-AS\00"
+data(138) = "g\19\01&\02\00\00\00@INDEX:NAME:SEND-AS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00J\00\00\00CN=Send-As,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2710\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2710\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2633\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2633\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1973\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1973\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2556\00"
+data(156) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2556\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1896\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1896\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3116\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3116\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=DOMAINDNS-DISPLAY,CN=412,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2027) = "g\19\01&\12\00\00\00CN=domainDNS-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00domainDNS-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001941\00uSNChanged\00\01\00\00\00\04\00\00\001941\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00domainDNS-Display\00objectGUID\00\01\00\00\00\10\00\00\00'jz\D3\DEu\B8J\B2\AC\FB\D3\14\AF\B2\A4\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\95\07\00\00\00\00\00\00\95\07\00\00\00\00\00\00\00adminPropertyPages\00\05\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe648c-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ef-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\09\00\00\00\EB\8F\84\EB\A9\94\EC\9D\B8\00adminContextMenu\00\02\00\00\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\EC\84\A4\EB\AA\85\00\09\00\00\00dc,\EC\9D\B4\EB\A6\84\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2479\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2479\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3039\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3039\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=site-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(38) = "DN=@INDEX:OBJECTCLASS:SUBNETCONTAINER\00"
+data(143) = "g\19\01&\02\00\00\00@INDEX:OBJECTCLASS:SUBNETCONTAINER\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00@\00\00\00CN=Subnets,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::0a87VV8xz0uLu6xiTuFf9w==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::0a87VV8xz0uLu6xiTuFf9w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2182\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2182\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=container-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(34) = "DN=@INDEX:NAME:PUBLIC-INFORMATION\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:NAME:PUBLIC-INFORMATION\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00U\00\00\00CN=Public-Information,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::n/tyJMXIOEyL1Vuxt6ppCw==\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::n/tyJMXIOEyL1Vuxt6ppCw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2981\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2981\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(112) = "DN=CN=FOREIGNSECURITYPRINCIPAL-DISPLAY,CN=408,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1876) = "g\19\01&\11\00\00\00CN=foreignSecurityPrincipal-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002321\00uSNChanged\00\01\00\00\00\04\00\00\002321\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00objectGUID\00\01\00\00\00\10\00\00\00\08CN\C4\EE\9ATK\B9g\1D\A3\A5\1B\E4\CC\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\09\00\00\00\00\00\00\11\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6486-a212-11d0-bcd5-00c04fd8d5b6}\00classDisplayName\00\01\00\00\000\00\00\00\CE\91\CF\81\CF\87\CE\AE \CE\B5\CE\BE\CF\89\CF\84\CE\B5\CF\81\CE\B9\CE\BA\CE\AE\CF\82 \CE\B1\CF\83\CF\86\CE\AC\CE\BB\CE\B5\CE\B9\CE\B1\CF\82\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\1E\00\00\00description,\CE\A0\CE\B5\CF\81\CE\B9\CE\B3\CF\81\CE\B1\CF\86\CE\AE\00\0D\00\00\00cn,\CE\8C\CE\BD\CE\BF\CE\BC\CE\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(94) = "DN=CN=SERVER-DISPLAY,CN=816,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1655) = "g\19\01&\10\00\00\00CN=server-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0E\00\00\00server-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002062\00uSNChanged\00\01\00\00\00\04\00\00\002062\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0E\00\00\00server-Display\00objectGUID\00\01\00\00\00\10\00\00\00\ECR\BB9\1F\AF\A8L\B5\E3\13\C0\C6U/\A6\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\0E\08\00\00\00\00\00\00\0E\08\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6494-a212-11d0-bcd5-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\08\00\00\00Servidor\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::R1FMhJ+YhUucXjtDplMmgA==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::R1FMhJ+YhUucXjtDplMmgA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::1GYJmHxmIUWJNj7tKlWZ+g==\00"
+data(196) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::1GYJmHxmIUWJNj7tKlWZ+g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3149\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3149\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2589\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2589\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::BN4bJbfasEu9GhHoRrFPBg==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::BN4bJbfasEu9GhHoRrFPBg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=msCOM-PartitionSet-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(52) = "DN=@INDEX:NAME:099F1587-AF70-49C6-AB6C-7B3E82BE0FE2\00"
+data(208) = "g\19\01&\02\00\00\00@INDEX:NAME:099F1587-AF70-49C6-AB6C-7B3E82BE0FE2\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=099f1587-af70-49c6-ab6c-7b3e82be0fe2,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Wi9aSqRTCk+D/VWym3w4PA==\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Wi9aSqRTCk+D/VWym3w4PA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::c8jtEUsEyUqFUNkffzUz/g==\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::c8jtEUsEyUqFUNkffzUz/g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::DuF1Rwpreky+INibhf7QDw==\00"
+data(203) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::DuF1Rwpreky+INibhf7QDw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=3467dae5-dedd-4648-9066-f48ac186b20a,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::+aTpte8isEGIUZilpJzzyA==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::+aTpte8isEGIUZilpJzzyA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1948\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1948\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2508\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2508\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(137) = "DN=CN=DEFAULT QUERY POLICY,CN=QUERY-POLICIES,CN=DIRECTORY SERVICE,CN=WINDOWS NT,CN=SERVICES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1644) = "g\19\01&\0E\00\00\00CN=Default Query Policy,CN=Query-Policies,CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\0B\00\00\00queryPolicy\00cn\00\01\00\00\00\14\00\00\00Default Query Policy\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001756\00uSNChanged\00\01\00\00\00\04\00\00\001756\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00Default Query Policy\00objectGUID\00\01\00\00\00\10\00\00\00\1F\B8\D6\FA7\FA\9FJ\9A\B8y\F2\06\9F\C2>\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00K\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DC\06\00\00\00\00\00\00\DC\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00F\00\00\00CN=Query-Policy,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00lDAPAdminLimits\00\0D\00\00\00\10\00\00\00MaxValRange=1500\00\19\00\00\00MaxReceiveBuffer=10485760\00\14\00\00\00MaxDatagramRecv=4096\00\10\00\00\00MaxPoolThreads=4\00\17\00\00\00MaxResultSetSize=262144\00\16\00\00\00MaxTempTableSize=10000\00\14\00\00\00MaxQueryDuration=120\00\10\00\00\00MaxPageSize=1000\00\18\00\00\00MaxNotificationPerConn=5\00\13\00\00\00MaxActiveQueries=20\00\13\00\00\00MaxConnIdleTime=900\00\13\00\00\00InitRecvTimeout=120\00\13\00\00\00MaxConnections=5000\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1651\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1651\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=DS-Replication-Manage-Topology,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2311\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2311\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=MSMQSETTINGS-DISPLAY,CN=415,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1791) = "g\19\01&\11\00\00\00CN=mSMQSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00mSMQSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002929\00uSNChanged\00\01\00\00\00\04\00\00\002929\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00mSMQSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00w\D8\E7\1A\D0\8EhE\82\07\DA\DF7\5C\89\DA\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCq\0B\00\00\00\00\00\00q\0B\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-255\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{d251b000-d46e-11d1-8091-00a024c48131}\00classDisplayName\00\01\00\00\00+\00\00\00Ustawienia us\C5\82ugi kolejkowania wiadomo\C5\9Bci\00adminContextMenu\00\01\00\00\00(\00\00\001,{d251b000-d46e-11d1-8091-00a024c48131}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2234\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2234\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=nTDSDSA-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2157\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2157\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=lostAndFound-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::d35iXzKm6UGs8BpRfbbu2A==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::d35iXzKm6UGs8BpRfbbu2A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=nTDSConnection-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(91) = "DN=@INDEX:@IDXONE:CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(5767) = "g\19\01&\02\00\00\00@INDEX:@IDXONE:CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\007\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=rpcContainer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=printQueue-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=computer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=volume-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=mSMQQueue-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=domainPolicy-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=site-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=nTDSSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=inetOrgPerson-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=nTDSConnection-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=nTDSService-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=IntellimirrorSCP-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=nTFRSSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=subnet-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=localPolicy-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=organizationalUnit-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=server-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00o\00\00\00CN=interSiteTransportContainer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=container-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=default-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=nTFRSMember-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=siteLinkBridge-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=subnetContainer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=nTDSSiteSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=msCOM-PartitionSet-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00j\00\00\00CN=pKICertificateTemplate-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=domainDNS-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=lostAndFound-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=trustedDomain-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=nTFRSSubscriber-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=msCOM-Partition-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=contact-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=nTDSDSA-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=serversContainer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Y\00\00\00CN=group-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=IntellimirrorGroup-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::b/3lC7Pszk6nhN6AVa5SKw==\00"
+data(203) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::b/3lC7Pszk6nhN6AVa5SKw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=f02915e2-9141-4f73-b8e7-2804662782da,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=EDA27B4A-E610-11D6-9793-00C04F613221,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=eda27b4a-e610-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\00eda27b4a-e610-11d6-9793-00c04f613221\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001684\00uSNChanged\00\01\00\00\00\04\00\00\001684\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\00eda27b4a-e610-11d6-9793-00c04f613221\00objectGUID\00\01\00\00\00\10\00\00\00\13\D8\09Er\87\BDJ\89\84B\AE\FB@\B2\15\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\94\06\00\00\00\00\00\00\94\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2582\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2582\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTFRSMember-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::OoNxZsnNn06pltvmlrG9FQ==\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::OoNxZsnNn06pltvmlrG9FQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2618\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2618\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=NTDSCONNECTION-DISPLAY,CN=412,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1677) = "g\19\01&\10\00\00\00CN=nTDSConnection-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\16\00\00\00nTDSConnection-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001955\00uSNChanged\00\01\00\00\00\04\00\00\001955\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00nTDSConnection-Display\00objectGUID\00\01\00\00\00\10\00\00\00{\DD\84\E2Q{\F6C\AA)\8A\B4#\C6V.\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A3\07\00\00\00\00\00\00\A3\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{717ef4fd-ac8d-11d0-b945-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\06\00\00\00\EC\97\B0\EA\B2\B0\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(43) = "DN=@INDEX:CN:ENTERPRISE DOMAIN CONTROLLERS\00"
+data(194) = "g\19\01&\02\00\00\00@INDEX:CN:ENTERPRISE DOMAIN CONTROLLERS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=Enterprise Domain Controllers,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=@INDEX:OBJECTCATEGORY:CN=SUBNET-CONTAINER,CN=SCHEMA,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(205) = "g\19\01&\02\00\00\00@INDEX:OBJECTCATEGORY:CN=SUBNET-CONTAINER,CN=SCHEMA,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00@\00\00\00CN=Subnets,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=DOMAINDNS-DISPLAY,CN=804,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2021) = "g\19\01&\12\00\00\00CN=domainDNS-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00domainDNS-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001885\00uSNChanged\00\01\00\00\00\04\00\00\001885\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00domainDNS-Display\00objectGUID\00\01\00\00\00\10\00\00\00\A7J|\A4:\FB\ECM\AFm\BE2\FD\B7\82\C0\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\07\00\00\00\00\00\00]\07\00\00\00\00\00\00\00adminPropertyPages\00\05\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe648c-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ef-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\03\00\00\00\E5\9F\9F\00adminContextMenu\00\02\00\00\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00dc,\E5\90\8D\E7\A7\B0\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(101) = "DN=CN=TRUSTEDDOMAIN-DISPLAY,CN=411,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1812) = "g\19\01&\11\00\00\00CN=trustedDomain-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\15\00\00\00trustedDomain-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003058\00uSNChanged\00\01\00\00\00\04\00\00\003058\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\15\00\00\00trustedDomain-Display\00objectGUID\00\01\00\00\00\10\00\00\00\FBI+1\A7\17\82K\B6v\92\9B\F4\90){\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\0B\00\00\00\00\00\00\F2\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd67-c63b-11d0-b94d-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00!\00\00\00\E4\BF\A1\E9\A0\BC\E3\81\95\E3\82\8C\E3\82\8B\E5\81\B4\E3\81\AE\E3\83\89\E3\83\A1\E3\82\A4\E3\83\B3\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\E8\AA\AC\E6\98\8E\00\09\00\00\00cn,\E5\90\8D\E5\89\8D\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2966\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2966\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(36) = "DN=@INDEX:NAME:MSMQSITELINK-DISPLAY\00"
+data(2597) = "g\19\01&\02\00\00\00@INDEX:NAME:MSMQSITELINK-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2889\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2889\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=inetOrgPerson-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::KuA44T/gH0mbhbkGv+Bwgw==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::KuA44T/gH0mbhbkGv+Bwgw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2692\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2692\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=licensingSiteSettings-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::ysUDGUkelE2LV7HNfb/1NQ==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::ysUDGUkelE2LV7HNfb/1NQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=default-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(29) = "DN=@INDEX:NAME:CREATOR OWNER\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:NAME:CREATOR OWNER\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=Creator Owner,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3098\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3098\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=MSMQSETTINGS-DISPLAY,CN=405,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1763) = "g\19\01&\11\00\00\00CN=mSMQSettings-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00mSMQSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002815\00uSNChanged\00\01\00\00\00\04\00\00\002815\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00mSMQSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00|\85\10\B0\A0\CF=E\99\22\91\B23w\8A\CB\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FF\0A\00\00\00\00\00\00\FF\0A\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-255\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{d251b000-d46e-11d1-8091-00a024c48131}\00classDisplayName\00\01\00\00\00\0F\00\00\00Nastaven\C3\AD MSMQ\00adminContextMenu\00\01\00\00\00(\00\00\001,{d251b000-d46e-11d1-8091-00a024c48131}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(90) = "DN=CN=AIA,CN=PUBLIC KEY SERVICES,CN=SERVICES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1167) = "g\19\01&\0D\00\00\00CN=AIA,CN=Public Key Services,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\03\00\00\00AIA\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001745\00uSNChanged\00\01\00\00\00\04\00\00\001745\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\03\00\00\00AIA\00objectGUID\00\01\00\00\00\10\00\00\00\FF\1C\DA\C2\85\03\FEN\860\9D\90\C5(\D6f\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\D1\06\00\00\00\00\00\00\D1\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::yAZt7tTyX0Sh3HQ8uzrJ8g==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::yAZt7tTyX0Sh3HQ8uzrJ8g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=siteLinkBridge-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1603\00"
+data(143) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1603\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00L\00\00\00CN=msmq-Send,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1626\00"
+data(154) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1626\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00W\00\00\00CN=Reanimate-Tombstones,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2109\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2109\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=DEFAULT-DISPLAY,CN=40B,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(3159) = "g\19\01&\13\00\00\00CN=default-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00default-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002978\00uSNChanged\00\01\00\00\00\04\00\00\002978\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00default-Display\00objectGUID\00\01\00\00\00\10\00\00\00\B9H^\EF\9D11G\93\E6<\9A\C2\D7r,\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\97\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A2\0B\00\00\00\00\00\00\A2\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00adminContextMenu\00\01\00\00\00(\00\00\000,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,Kuvaus\00\07\00\00\00cn,Nimi\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00extraColumns\00\1B\00\00\002\00\00\00msds-PhoneticDepartment,Foneettinen osasto,0,100,0\00;\00\00\00msds-PhoneticCompanyName,Foneettinen yrityksen nimi,0,100,0\002\00\00\00msds-PhoneticLastName,Foneettinen sukunimi,0,100,0\002\00\00\00msds-PhoneticFirstName,Foneettinen etunimi,0,100,0\009\00\00\00msds-PhoneticDisplayName,Foneettinen n\C3\A4ytt\C3\B6nimi,0,100,0\00\1E\00\00\00postalCode,Postinumero,0,100,0\005\00\00\00textEncodedORAddress,X.400-s\C3\A4hk\C3\B6postiosoite,0,130,0\006\00\00\00userPrincipalName,K\C3\A4ytt\C3\A4j\C3\A4n kirjautumisnimi,0,200,0\00\1D\00\00\00title,Teht\C3\A4v\C3\A4nimike,0,100,0\00!\00\00\00targetAddress,Kohdeosoite,0,100,0\00\11\00\00\00st,Valtio,0,100,0\00+\00\00\00physicalDeliveryOfficeName,Toimisto,0,100,0\00\1C\00\00\00whenChanged,Muokattu,0,130,0\00\13\00\00\00sn,Sukunimi,0,100,0\004\00\00\00msExchIMMetaPhysicalURL,Pikaviestityksen URL,0,140,0\009\00\00\00msExchIMPhysicalURL,Pikaviestityksen kotipalvelin,0,170,0\00\19\00\00\00givenName,Etunimi,0,100,0\00,\00\00\00homeMDB,Exchange-s\C3\A4hk\C3\B6postis\C3\A4il\C3\B6,0,100,0\00#\00\00\00mailNickname,Exchange-alias,0,175,0\00\1F\00\00\00mail,S\C3\A4hk\C3\B6postiosoite,0,100,0\00A\00\00\00sAMAccountName,Windows 2000:ta edelt\C3\A4v\C3\A4 kirjautumisnimi,0,120,0\00 \00\00\00displayName,N\C3\A4ytt\C3\B6nimi,0,100,0\00\19\00\00\00department,Osasto,0,150,0\00\0C\00\00\00c,Maa,0,-1,0\00\16\00\00\00company,Yritys,0,150,0\00\12\00\00\00l,Kaupunki,0,150,0\00)\00\00\00telephoneNumber,Ty\C3\B6puhelinnumero,0,100,0\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30563-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(110) = "DN=CN=PKICERTIFICATETEMPLATE-DISPLAY,CN=414,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2087) = "g\19\01&\14\00\00\00CN=pKICertificateTemplate-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002266\00uSNChanged\00\01\00\00\00\04\00\00\002266\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00objectGUID\00\01\00\00\00\10\00\00\00\CC\15p\DF\EF\14C@\A8\A1\85\DD\F3jBu\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DA\08\00\00\00\00\00\00\DA\08\00\00\00\00\00\00\00iconPath\00\01\00\00\00\13\00\00\000,certtmpl.dll,-144\00contextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00classDisplayName\00\01\00\00\00\0D\00\00\00Sertifikatmal\00adminContextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00attributeDisplayNames\00\02\00\00\00\17\00\00\00description,Beskrivelse\00\07\00\00\00cn,Navn\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2611\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2611\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::HXoloYP3W0mHEN6GOx729A==\00"
+data(193) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::HXoloYP3W0mHEN6GOx729A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1974\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1974\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2534\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2534\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1897\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1897\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(101) = "DN=CN=TRUSTEDDOMAIN-DISPLAY,CN=407,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1800) = "g\19\01&\11\00\00\00CN=trustedDomain-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\15\00\00\00trustedDomain-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002015\00uSNChanged\00\01\00\00\00\04\00\00\002015\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\15\00\00\00trustedDomain-Display\00objectGUID\00\01\00\00\00\10\00\00\00;z\19\D9\81l\D4A\BC*\C7N\B6\EFM\AF\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DF\07\00\00\00\00\00\00\DF\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd67-c63b-11d0-b94d-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\11\00\00\00Vertraute Dom\C3\A4ne\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\18\00\00\00description,Beschreibung\00\07\00\00\00cn,Name\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2260\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2260\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00o\00\00\00CN=interSiteTransportContainer-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(37) = "DN=@INDEX:DNSROOT:ALPHA13.SAMBA.CORP\00"
+data(320) = "g\19\01&\02\00\00\00@INDEX:DNSROOT:ALPHA13.SAMBA.CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\03\00\00\00V\00\00\00CN=Enterprise Configuration,CN=Partitions,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00O\00\00\00CN=Enterprise Schema,CN=Partitions,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00C\00\00\00CN=SAMBA,CN=Partitions,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2183\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2183\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::hxepJhfwZUSjDKRkfA3aKg==\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::hxepJhfwZUSjDKRkfA3aKg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(92) = "DN=CN=USER-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(4421) = "g\19\01&\15\00\00\00CN=user-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0C\00\00\00user-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002835\00uSNChanged\00\01\00\00\00\04\00\00\002835\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0C\00\00\00user-Display\00objectGUID\00\01\00\00\00\10\00\00\00\AA\0F\8A\FCX\DF\9FA\92\B1\01\03\91\9D7\0A\00replPropertyMetaData\00\01\00\00\00\10\03\00\00\01\00\00\00\00\00\00\00\10\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\13\0B\00\00\00\00\00\00\13\0B\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\0A\00\00\00)\00\00\0011,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00)\00\00\0010,{4c796c30-f96b-11d2-ac78-0008c7726cf7}\00(\00\00\009,{FA3E1D55-16DF-446d-872E-BD04D4F39C93}\00(\00\00\008,{0910dd01-df8c-11d1-ae27-00c04fa35813}\00(\00\00\007,{8c5b1b50-d46e-11d1-8091-00a024c48131}\00(\00\00\006,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\005,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\004,{FD57D295-4FD9-11D1-854E-00C04FC31FD3}\00(\00\00\003,{B52C1E50-1DD2-11D1-BC43-00C04FC31FD3}\00(\00\00\001,{6dfe6485-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ed-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\04\00\00\00User\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00<\00\00\00\1C\00\00\00wWWHomePage,Web Page Address\00\1C\00\00\00userPrincipalName,Logon Name\00#\00\00\00userWorkstations,Logon Workstations\00\18\00\00\00displayName,Display Name\00\1D\00\00\00url,Web Page Address (Others)\00\0F\00\00\00title,Job Title\00!\00\00\00telexNumber,Telex Number (Others)\00 \00\00\00telephoneNumber,Telephone Number\00\1C\00\00\00streetAddress,Street Address\00\11\00\00\00st,State/Province\00\0C\00\00\00sn,Last Name\00,\00\00\00samAccountName,Logon Name (pre-Windows 2000)\00\1F\00\00\00primaryTelexNumber,Telex Number\008\00\00\00primaryInternationalISDNNumber,International ISDN Number\00\1D\00\00\00postOfficeBox,Post Office Box\00\1A\00\00\00postalCode,ZIP/Postal Code\00*\00\00\00physicalDeliveryOfficeName,Office Location\00\13\00\00\00personalTitle,Title\00\12\00\00\00pager,Pager Number\00$\00\00\00otherTelephone,Phone Number (Others)\00 \00\00\00otherPager,Pager Number (Others)\00\22\00\00\00otherMobile,Mobile Number (Others)\00$\00\00\00otherMailbox,E-Mail Address (Others)\00%\00\00\00otherIpPhone,IP Phone Number (Others)\00)\00\00\00otherHomePhone,Home Phone Number (Others)\001\00\00\00otherFacsimileTelephoneNumber,Fax Number (Others)\00\0A\00\00\00info,Notes\00+\00\00\00mSDS-PhoneticDepartment,Phonetic Department\00.\00\00\00mSDS-PhoneticCompanyName,Phonetic Company Name\00.\00\00\00mSDS-PhoneticDisplayName,Phonetic Display Name\00(\00\00\00mSDS-PhoneticLastName,Phonetic Last Name\00*\00\00\00mSDS-PhoneticFirstName,Phonetic First Name\00\14\00\00\00mobile,Mobile Number\00\16\00\00\00middleName,Middle Name\00\12\00\00\00memberOf,Member Of\00\0F\00\00\00manager,Manager\00\13\00\00\00mail,E-Mail Address\00\06\00\00\00l,City\00\17\00\00\00ipPhone,IP Phone Number\00:\00\00\00internationalISDNNumber,International ISDN Number (Others)\00\11\00\00\00initials,Initials\00\1E\00\00\00homePostalAddress,Home Address\00\14\00\00\00homePhone,Home Phone\00\14\00\00\00homeDrive,Home Drive\00\19\00\00\00homeDirectory,Home Folder\00\14\00\00\00givenName,First Name\00'\00\00\00generationQualifier,Generational Suffix\00#\00\00\00facsimileTelephoneNumber,Fax Number\00\16\00\00\00employeeID,Employee ID\00\11\00\00\00division,Division\00$\00\00\00distinguishedName,Distinguished Name\00\1C\00\00\00directReports,Direct Reports\00\17\00\00\00description,Description\00\15\00\00\00department,Department\00\0F\00\00\00company,Company\00\0F\00\00\00comment,Comment\00\0A\00\00\00co,Country\00\16\00\00\00c,Country Abbreviation\00\07\00\00\00cn,Name\00\13\00\00\00assistant,Assistant\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30564-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2219\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2219\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::P9T3EpoMekG/btUM0Ewypg==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::P9T3EpoMekG/btUM0Ewypg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=rpcContainer-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::ze52lUiGqUSeW8kpt5rSdg==\00"
+data(175) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::ze52lUiGqUSeW8kpt5rSdg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00W\00\00\00CN=Change-Schema-Master,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(21) = "DN=@INDEX:CN:SERVERS\00"
+data(153) = "g\19\01&\02\00\00\00@INDEX:CN:SERVERS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=Servers,CN=Default-First-Site-Name,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Y/OqbO8GwkmuDkcGoPUo1A==\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Y/OqbO8GwkmuDkcGoPUo1A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2918\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2918\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=licensingSiteSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2721\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2721\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=IntellimirrorGroup-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2644\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2644\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=8F86B825-C322-4101-ADC4-579F12D445DB,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=8f86b825-c322-4101-adc4-579f12d445db,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\008f86b825-c322-4101-adc4-579f12d445db\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001717\00uSNChanged\00\01\00\00\00\04\00\00\001717\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\008f86b825-c322-4101-adc4-579f12d445db\00objectGUID\00\01\00\00\00\10\00\00\00?\FAR\F0\94j\15G\97+\EC\15\C2\93\02\1E\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B5\06\00\00\00\00\00\00\B5\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2567\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2567\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=nTDSSettings-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(101) = "DN=CN=TRUSTEDDOMAIN-DISPLAY,CN=C04,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1797) = "g\19\01&\11\00\00\00CN=trustedDomain-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\15\00\00\00trustedDomain-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002183\00uSNChanged\00\01\00\00\00\04\00\00\002183\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\15\00\00\00trustedDomain-Display\00objectGUID\00\01\00\00\00\10\00\00\00uk\FF\16\B6\D0YA\88\E0S\A4\17A\C6\D5\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\87\08\00\00\00\00\00\00\87\08\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd67-c63b-11d0-b94d-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\12\00\00\00\E5\8F\97\E4\BF\A1\E4\BB\BB\E7\9A\84\E7\B6\B2\E5\9F\9F\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00cn,\E5\90\8D\E7\A8\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2370\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2370\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2293\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2293\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=organizationalUnit-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=MSMQSITELINK-DISPLAY,CN=411,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1891) = "g\19\01&\12\00\00\00CN=mSMQSiteLink-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00mSMQSiteLink-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003073\00uSNChanged\00\01\00\00\00\04\00\00\003073\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00mSMQSiteLink-Display\00objectGUID\00\01\00\00\00\10\00\00\00v\B8\F3\9F\0D\CC_I\BBG\D2\11\88\8C\AE\B7\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\F2\01\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\01\0C\00\00\00\00\00\00\01\0C\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-254\00creationWizard\00\01\00\00\00&\00\00\00{87b31390-d46d-11d1-8091-00a024c48131}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{87b31390-d46d-11d1-8091-00a024c48131}\00classDisplayName\00\01\00\00\00!\00\00\00MSMQ \E3\83\AB\E3\83\BC\E3\83\86\E3\82\A3\E3\83\B3\E3\82\B0 \E3\83\AA\E3\83\B3\E3\82\AF\00adminContextMenu\00\01\00\00\00(\00\00\001,{87b31390-d46d-11d1-8091-00a024c48131}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(38) = "DN=@INDEX:OBJECTSID::AQEAAAAAAAUJAAAA\00"
+data(189) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQEAAAAAAAUJAAAA\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=Enterprise Domain Controllers,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=LOSTANDFOUND-DISPLAY,CN=404,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2057) = "g\19\01&\13\00\00\00CN=lostAndFound-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00lostAndFound-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002549\00uSNChanged\00\01\00\00\00\04\00\00\002549\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00lostAndFound-Display\00objectGUID\00\01\00\00\00\10\00\00\00\5C\86*Z\11i\FBE\86\C9r\15\1F\A7\1D\DE\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\97\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\09\00\00\00\00\00\00\F5\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00adminContextMenu\00\01\00\00\00(\00\00\000,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00cn,\E5\90\8D\E7\A8\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00extraColumns\00\01\00\00\00*\00\00\00lastKnownParent,\E4\B8\8A\E6\AC\A1\E5\B7\B2\E7\9F\A5\E7\88\B6\E7\B3\BB,1,300,0\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30563-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(90) = "DN=CN=SMTP,CN=INTER-SITE TRANSPORTS,CN=SITES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1434) = "g\19\01&\10\00\00\00CN=SMTP,CN=Inter-Site Transports,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\12\00\00\00interSiteTransport\00cn\00\01\00\00\00\04\00\00\00SMTP\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001762\00uSNChanged\00\01\00\00\00\04\00\00\001762\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\04\00\00\00SMTP\00objectGUID\00\01\00\00\00\10\00\00\00z:\7F\C9\16\F1wH\9FmD\96\92\E7e\94\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\003\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\15\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\7F\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\06\00\00\00\00\00\00\E2\06\00\00\00\00\00\00\00options\00\01\00\00\00\01\00\00\001\00objectCategory\00\01\00\00\00N\00\00\00CN=Inter-Site-Transport,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00transportDLLName\00\01\00\00\00\0B\00\00\00ismsmtp.dll\00transportAddressAttribute\00\01\00\00\00\0B\00\00\00mailAddress\00"
+}
+{
+key(47) = "DN=@INDEX:NAME:DS-REPLICATION-MONITOR-TOPOLOGY\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:NAME:DS-REPLICATION-MONITOR-TOPOLOGY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-Replication-Monitor-Topology,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::3xQuroQ0u0m4snYR5av4dw==\00"
+data(204) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::3xQuroQ0u0m4snYR5av4dw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00t\00\00\00CN=NTDS Settings,CN=ARES,CN=Servers,CN=Default-First-Site-Name,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(99) = "DN=CN=NTFRSMEMBER-DISPLAY,CN=C0A,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1676) = "g\19\01&\10\00\00\00CN=nTFRSMember-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\13\00\00\00nTFRSMember-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002638\00uSNChanged\00\01\00\00\00\04\00\00\002638\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00nTFRSMember-Display\00objectGUID\00\01\00\00\00\10\00\00\00(X\01\E7\BE\19cJ\A3\CC3\AA\C9\9D\1E\DE\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCN\0A\00\00\00\00\00\00N\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd6a-c63b-11d0-b94d-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\0E\00\00\00Miembro de FRS\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::KXqD1gsaY0GJNC2GurFmwg==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::KXqD1gsaY0GJNC2GurFmwg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1926\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1926\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1849\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1849\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:CN:613BD063-E8E9-4A62-8F4C-CDA566F7EB6F\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:613BD063-E8E9-4A62-8F4C-CDA566F7EB6F\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=613bd063-e8e9-4a62-8f4c-cda566f7eb6f,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1652\00"
+data(154) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1652\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00W\00\00\00CN=Change-Schema-Master,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2212\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2212\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=msCOM-Partition-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2135\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2135\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSSubscriber-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(112) = "DN=CN=FOREIGNSECURITYPRINCIPAL-DISPLAY,CN=412,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1832) = "g\19\01&\11\00\00\00CN=foreignSecurityPrincipal-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001985\00uSNChanged\00\01\00\00\00\04\00\00\001985\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00objectGUID\00\01\00\00\00\10\00\00\00\18zudH\1FY@\B9^\F3\C6\99\B0\EB\9F\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C1\07\00\00\00\00\00\00\C1\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6486-a212-11d0-bcd5-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\14\00\00\00\EC\99\B8\EB\B6\80 \EB\B3\B4\EC\95\88 \EC\A3\BC\EC\B2\B4\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\EC\84\A4\EB\AA\85\00\09\00\00\00cn,\EC\9D\B4\EB\A6\84\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:CN:94F238BD-831C-11D6-977B-00C04F613221\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:94F238BD-831C-11D6-977B-00C04F613221\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=94f238bd-831c-11d6-977b-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1959\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1959\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::ith0SuWqQ0yMslS5g+nZYg==\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::ith0SuWqQ0yMslS5g+nZYg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2519\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2519\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=DOMAINDNS-DISPLAY,CN=405,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2024) = "g\19\01&\12\00\00\00CN=domainDNS-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00domainDNS-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002781\00uSNChanged\00\01\00\00\00\04\00\00\002781\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00domainDNS-Display\00objectGUID\00\01\00\00\00\10\00\00\00\F9\A4\E9\B5\EF\22\B0A\88Q\98\A5\A4\9C\F3\C8\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\0A\00\00\00\00\00\00\DD\0A\00\00\00\00\00\00\00adminPropertyPages\00\05\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe648c-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ef-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\07\00\00\00Dom\C3\A9na\00adminContextMenu\00\02\00\00\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\02\00\00\00\11\00\00\00description,Popis\00\09\00\00\00dc,Jm\C3\A9no\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2322\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2322\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::h/ungjCAiEGGvaE3+YbTtA==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::h/ungjCAiEGGvaE3+YbTtA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=nTDSConnection-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1685\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1685\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=26d9c510-e61a-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2245\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2245\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2168\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2168\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(23) = "DN=@INDEX:CN:MSMQ-PEEK\00"
+data(140) = "g\19\01&\02\00\00\00@INDEX:CN:MSMQ-PEEK\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00L\00\00\00CN=msmq-Peek,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(98) = "DN=CN=PRINTQUEUE-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2863) = "g\19\01&\13\00\00\00CN=printQueue-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\12\00\00\00printQueue-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002844\00uSNChanged\00\01\00\00\00\04\00\00\002844\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\12\00\00\00printQueue-Display\00objectGUID\00\01\00\00\00\10\00\00\00J\08\F3\8Ddp*D\8FD\1C\00\01i\B2\91\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1C\0B\00\00\00\00\00\00\1C\0B\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6493-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f5-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\07\00\00\00Printer\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\1B\00\00\00\1C\00\00\00versionNumber,Object Version\00\14\00\00\00url,Web Page Address\00\16\00\00\00serverName,Server Name\00(\00\00\00printStaplingSupported,Supports Stapling\00\19\00\00\00printShareName,Share Name\00$\00\00\00printPagesPerMinute,Pages per Minute\00\19\00\00\00printRateUnit,Speed Units\00\0F\00\00\00printRate,Speed\00\15\00\00\00printOwner,Owner Name\00\1C\00\00\00printMemory,Installed Memory\00)\00\00\00printMediaSupported,Paper Types Supported\00\1F\00\00\00printMediaReady,Paper Available\00.\00\00\00printMaxResolutionSupported,Maximum Resolution\00\1E\00\00\00printLanguage,Printer Language\00\10\00\00\00printerName,Name\003\00\00\00printDuplexSupported,Supports Double-sided Printing\00\22\00\00\00printColor,Supports Color Printing\00\1F\00\00\00printCollate,Supports Collation\00\19\00\00\00printBinNames,Input Trays\00\0D\00\00\00portName,Port\00\11\00\00\00location,Location\00\10\00\00\00driverName,Model\00\13\00\00\00description,Comment\00\13\00\00\00contactName,Contact\00\18\00\00\00assetNumber,Asset Number\00\14\00\00\00uNCName,Network Name\00\19\00\00\00cn,Directory Service Name\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2967\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2967\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=site-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(42) = "DN=@INDEX:NAME:DS-REPLICATION-SYNCHRONIZE\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:NAME:DS-REPLICATION-SYNCHRONIZE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=DS-Replication-Synchronize,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(99) = "DN=CN=QUERYPOLICY-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1674) = "g\19\01&\10\00\00\00CN=queryPolicy-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\13\00\00\00queryPolicy-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002880\00uSNChanged\00\01\00\00\00\04\00\00\002880\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00queryPolicy-Display\00objectGUID\00\01\00\00\00\10\00\00\00z{\CD8\18\5C\B6I\87\FA\13\87\04z\F6&\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC@\0B\00\00\00\00\00\00@\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0C\00\00\00Query Policy\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2670\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2670\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2593\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2593\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3099\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3099\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::ywxZ8Pt7CkuiTXUymKa8eQ==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::ywxZ8Pt7CkuiTXUymKa8eQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1604\00"
+data(154) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1604\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00W\00\00\00CN=msmq-Receive-journal,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::bYNvaBVA0UK+q8od4uLaxg==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::bYNvaBVA0UK+q8od4uLaxg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::9J4KsyXDrUaalGQA20YsGQ==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::9J4KsyXDrUaalGQA20YsGQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSSubscriber-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::e8ZbW7ylf0eurVWtCQx5og==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::e8ZbW7ylf0eurVWtCQx5og==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(91) = "DN=@INDEX:@IDXONE:CN=816,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(5767) = "g\19\01&\02\00\00\00@INDEX:@IDXONE:CN=816,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\007\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00j\00\00\00CN=pKICertificateTemplate-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=server-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=nTFRSSubscriber-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=domainDNS-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=computer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=nTFRSSettings-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=msCOM-Partition-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=serversContainer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Y\00\00\00CN=group-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=organizationalUnit-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=nTDSService-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=mSMQQueue-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=IntellimirrorSCP-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=inetOrgPerson-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=localPolicy-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=site-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=siteLinkBridge-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=default-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=lostAndFound-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=msCOM-PartitionSet-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00o\00\00\00CN=interSiteTransportContainer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=volume-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=nTFRSMember-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=contact-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=domainPolicy-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSettings-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=container-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=nTDSSettings-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=subnet-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=rpcContainer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=trustedDomain-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=nTDSDSA-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=IntellimirrorGroup-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=nTDSSiteSettings-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=nTDSConnection-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=printQueue-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=subnetContainer-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::JwhxF1Xerkmfr92zII8uYA==\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::JwhxF1Xerkmfr92zII8uYA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=INTELLIMIRRORSCP-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1700) = "g\19\01&\10\00\00\00CN=IntellimirrorSCP-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002834\00uSNChanged\00\01\00\00\00\04\00\00\002834\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00objectGUID\00\01\00\00\00\10\00\00\00C\03_\BD!\E1IG\8D'\FF\E4\00\F0.\A9\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\12\0B\00\00\00\00\00\00\12\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4e40f770-369c-11d0-8922-00a024ab2dbb}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00classDisplayName\00\01\00\00\00\15\00\00\00IntelliMirror Service\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::+sSegOuywESfJdAQuQwcqg==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::+sSegOuywESfJdAQuQwcqg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=organizationalUnit-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3363\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3363\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=Local Service,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(76) = "DN=CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1153) = "g\19\01&\0D\00\00\00CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\03\00\00\0041F\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002999\00uSNChanged\00\01\00\00\00\04\00\00\002999\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\03\00\00\0041F\00objectGUID\00\01\00\00\00\10\00\00\00\9Ct7\02\B9\B1\FEB\AA\9A\11\B0@\08\A3\06\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B7\0B\00\00\00\00\00\00\B7\0B\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1714\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1714\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=6eb8eaf9-3403-4ba5-8b4b-ce349a4680ad,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1637\00"
+data(141) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1637\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00J\00\00\00CN=Send-As,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:CN:20BF09B4-6D0B-4CD1-9C09-4231EDF1209B\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:20BF09B4-6D0B-4CD1-9C09-4231EDF1209B\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=20bf09b4-6d0b-4cd1-9c09-4231edf1209b,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(99) = "DN=CN=QUERYPOLICY-DISPLAY,CN=408,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1699) = "g\19\01&\10\00\00\00CN=queryPolicy-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\13\00\00\00queryPolicy-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002320\00uSNChanged\00\01\00\00\00\04\00\00\002320\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00queryPolicy-Display\00objectGUID\00\01\00\00\00\10\00\00\00\11x\92\B6\8C\97\B9D\BF\0Fo\BCI\D6\C5{\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\10\09\00\00\00\00\00\00\10\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00%\00\00\00\CE\A0\CE\BF\CE\BB\CE\B9\CF\84\CE\B9\CE\BA\CE\AE \CE\B5\CF\81\CF\89\CF\84\CE\AE\CE\BC\CE\B1\CF\84\CE\BF\CF\82\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2000\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2000\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::0toy9N3rzki9fwn+J61RHA==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::0toy9N3rzki9fwn+J61RHA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2919\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2919\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=PKICERTIFICATETEMPLATE-DISPLAY,CN=804,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2083) = "g\19\01&\14\00\00\00CN=pKICertificateTemplate-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001930\00uSNChanged\00\01\00\00\00\04\00\00\001930\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00objectGUID\00\01\00\00\00\10\00\00\00\B34\B7m\B3\91VN\80\1D\1C\8E\BA\FE\AD\A5\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8A\07\00\00\00\00\00\00\8A\07\00\00\00\00\00\00\00iconPath\00\01\00\00\00\13\00\00\000,certtmpl.dll,-144\00contextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00classDisplayName\00\01\00\00\00\0C\00\00\00\E8\AF\81\E4\B9\A6\E6\A8\A1\E6\9D\BF\00adminContextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00cn,\E5\90\8D\E7\A7\B0\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2722\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2722\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=IntellimirrorSCP-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1985\00"
+data(175) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1985\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2645\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2645\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=DS-UI-DEFAULT-SETTINGS,CN=401,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1680) = "g\19\01&\10\00\00\00CN=DS-UI-Default-Settings,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\0C\00\00\00dSUISettings\00cn\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002440\00uSNChanged\00\01\00\00\00\04\00\00\002440\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00objectGUID\00\01\00\00\00\10\00\00\00\FC\10l\FB\1D\B9dO\9F[\F9)59\FE\AD\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00?\05\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\99\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\A7\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\88\09\00\00\00\00\00\00\88\09\00\00\00\00\00\00\00objectCategory\00\01\00\00\00H\00\00\00CN=DS-UI-Settings,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00dSUIAdminNotification\00\02\00\00\00(\00\00\002,{a00e1768-4a9b-4d97-afc6-99d329f605f2}\00(\00\00\001,{E62F8206-B71C-11D1-808D-00A024C48131}\00msDS-Non-Security-Group-Extra-Classes\00\02\00\00\00\13\00\00\00mSMQCustomRecipient\00\09\00\00\00mSMQQueue\00msDS-FilterContainers\00\05\00\00\00\08\00\00\00dns-Zone\00\09\00\00\00Container\00\0E\00\00\00Lost-And-Found\00\0E\00\00\00Builtin-Domain\00\13\00\00\00Organizational-Unit\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::rI7L4uiaokaBYUtB7V1L/w==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::rI7L4uiaokaBYUtB7V1L/w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=Anonymous Logon,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2568\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2568\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3128\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3128\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::GYA85QEEG0qjXxbupqLXTQ==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::GYA85QEEG0qjXxbupqLXTQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2271\00"
+data(139) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2271\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(17) = "DN=@INDEX:CN:401\00"
+data(130) = "g\19\01&\02\00\00\00@INDEX:CN:401\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2194\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2194\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2993\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2993\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(50) = "DN=@INDEX:CN:96541A16-910A-4B66-ACDE-720A0DFF03C7\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:96541A16-910A-4B66-ACDE-720A0DFF03C7\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=96541a16-910a-4b66-acde-720a0dff03c7,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=PKICERTIFICATETEMPLATE-DISPLAY,CN=404,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2083) = "g\19\01&\14\00\00\00CN=pKICertificateTemplate-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002546\00uSNChanged\00\01\00\00\00\04\00\00\002546\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00objectGUID\00\01\00\00\00\10\00\00\00TN\E6P\9F\19~D\A0\88\1C\D9\99\C8\85T\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F2\09\00\00\00\00\00\00\F2\09\00\00\00\00\00\00\00iconPath\00\01\00\00\00\13\00\00\000,certtmpl.dll,-144\00contextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00classDisplayName\00\01\00\00\00\0C\00\00\00\E6\86\91\E8\AD\89\E7\AF\84\E6\9C\AC\00adminContextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00cn,\E5\90\8D\E7\A8\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=SITELINKBRIDGE-DISPLAY,CN=414,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1689) = "g\19\01&\10\00\00\00CN=siteLinkBridge-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\16\00\00\00siteLinkBridge-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002242\00uSNChanged\00\01\00\00\00\04\00\00\002242\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00siteLinkBridge-Display\00objectGUID\00\01\00\00\00\10\00\00\00\BD\10-\B9*\E5\FDI\A5\F4\FA^\07rI\5C\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C2\08\00\00\00\00\00\00\C2\08\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30562-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\12\00\00\00Omr\C3\A5dekoblingsbro\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=MSMQMIGRATEDUSER-DISPLAY,CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1618) = "g\19\01&\10\00\00\00CN=mSMQMigratedUser-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003008\00uSNChanged\00\01\00\00\00\04\00\00\003008\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00mSMQMigratedUser-Display\00objectGUID\00\01\00\00\00\10\00\00\00\D4\BC\18\22hz2G\88\E6\81;\11\0C\19x\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\C0\0B\00\00\00\00\00\00\C0\0B\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00classDisplayName\00\01\00\00\00\1F\00\00\00MSMQ Y\C3\BCkseltilmi\C5\9F Kullan\C4\B1c\C4\B1\00adminContextMenu\00\01\00\00\00(\00\00\001,{fc5bf656-0b7f-11d3-883f-006094eb6406}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(112) = "DN=CN=FOREIGNSECURITYPRINCIPAL-DISPLAY,CN=41D,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1839) = "g\19\01&\11\00\00\00CN=foreignSecurityPrincipal-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002713\00uSNChanged\00\01\00\00\00\04\00\00\002713\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00 \00\00\00foreignSecurityPrincipal-Display\00objectGUID\00\01\00\00\00\10\00\00\00\BD=BN\E0\F4(L\9A\8A\CBg\15\E2\BD\E9\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\99\0A\00\00\00\00\00\00\99\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6486-a212-11d0-bcd5-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\18\00\00\00Externt s\C3\A4kerhetsobjekt\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\17\00\00\00description,Beskrivning\00\07\00\00\00cn,Namn\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::GHp1ZEgfWUC5XvPGmbDrnw==\00"
+data(196) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::GHp1ZEgfWUC5XvPGmbDrnw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::iGQC7hAkEkqSZJHEl6ot1w==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::iGQC7hAkEkqSZJHEl6ot1w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::8Y1LFJzc50WCXbzIJ5f4Og==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::8Y1LFJzc50WCXbzIJ5f4Og==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=IntellimirrorGroup-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(99) = "DN=CN=QUERYPOLICY-DISPLAY,CN=407,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1679) = "g\19\01&\10\00\00\00CN=queryPolicy-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\13\00\00\00queryPolicy-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002040\00uSNChanged\00\01\00\00\00\04\00\00\002040\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00queryPolicy-Display\00objectGUID\00\01\00\00\00\10\00\00\00\A6PY=m^>J\BC\06\05\A4\09\01\1Cb\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F8\07\00\00\00\00\00\00\F8\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\11\00\00\00Abfragerichtlinie\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1630\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1630\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=Update-Password-Not-Required-Bit,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(37) = "DN=@INDEX:NAME:ACTIVEDIRECTORYUPDATE\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:NAME:ACTIVEDIRECTORYUPDATE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=ActiveDirectoryUpdate,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(83) = "DN=CN=PUBLIC KEY SERVICES,CN=SERVICES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1192) = "g\19\01&\0D\00\00\00CN=Public Key Services,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\13\00\00\00Public Key Services\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001741\00uSNChanged\00\01\00\00\00\04\00\00\001741\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00Public Key Services\00objectGUID\00\01\00\00\00\10\00\00\00!E\83\86\AA\19\13M\A0S\0Dh\E2Dd\BD\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CD\06\00\00\00\00\00\00\CD\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(103) = "DN=CN=NTFRSSUBSCRIBER-DISPLAY,CN=816,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1691) = "g\19\01&\10\00\00\00CN=nTFRSSubscriber-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\17\00\00\00nTFRSSubscriber-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002079\00uSNChanged\00\01\00\00\00\04\00\00\002079\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\17\00\00\00nTFRSSubscriber-Display\00objectGUID\00\01\00\00\00\10\00\00\00\C3\D4\AB)\0A\05\CFO\B13\D3\C4_U\86\8D\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1F\08\00\00\00\00\00\00\1F\08\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d3055f-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\11\00\00\00Subscritor de FRS\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::4EbQjCr0+UKwk+3y9XdY/w==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::4EbQjCr0+UKwk+3y9XdY/w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::8tCXfjLQuUW6OazjMDrpFA==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::8tCXfjLQuUW6OazjMDrpFA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=EDA27B48-E610-11D6-9793-00C04F613221,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=eda27b48-e610-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\00eda27b48-e610-11d6-9793-00c04f613221\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001682\00uSNChanged\00\01\00\00\00\04\00\00\001682\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\00eda27b48-e610-11d6-9793-00c04f613221\00objectGUID\00\01\00\00\00\10\00\00\00Pl\1F\D07\09\C5I\8AY]\CC\E1\CB\BD\FA\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\92\06\00\00\00\00\00\00\92\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(28) = "DN=@INDEX:CN:QUERY-POLICIES\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:CN:QUERY-POLICIES\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=Query-Policies,CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(38) = "DN=@INDEX:OBJECTSID::AQEAAAAAAAUTAAAA\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:OBJECTSID::AQEAAAAAAAUTAAAA\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=Local Service,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=CONTAINER-DISPLAY,CN=419,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2168) = "g\19\01&\13\00\00\00CN=container-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00container-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002350\00uSNChanged\00\01\00\00\00\04\00\00\002350\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00container-Display\00objectGUID\00\01\00\00\00\10\00\00\00\A1\96\FB\D0\A2[\06@\BA4\85\96\11\ED\FCi\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\09\00\00\00\00\00\00.\09\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{5a96f2d8-736e-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\12\00\00\00\D0\9A\D0\BE\D0\BD\D1\82\D0\B5\D0\B9\D0\BD\D0\B5\D1\80\00adminContextMenu\00\04\00\00\00(\00\00\004,{AB790AA1-CDC1-478a-9351-B2E05CFCAD09}\00(\00\00\003,{EEBD2F15-87EE-4F93-856F-6AD7E31787B3}\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\02\00\00\00\1C\00\00\00description,\D0\9E\D0\BF\D0\B8\D1\81\D0\B0\D0\BD\D0\B8\D0\B5\00\16\00\00\00cn,\D0\9F\D0\BE\D0\BB\D0\BD\D0\BE\D0\B5 \D0\B8\D0\BC\D1\8F\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=INTELLIMIRRORSCP-DISPLAY,CN=408,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1709) = "g\19\01&\10\00\00\00CN=IntellimirrorSCP-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002274\00uSNChanged\00\01\00\00\00\04\00\00\002274\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00objectGUID\00\01\00\00\00\10\00\00\00Tj\C6\09-\88d@\AA\95\B7\C2\FF+\ED\03\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\08\00\00\00\00\00\00\E2\08\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4e40f770-369c-11d0-8922-00a024ab2dbb}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00classDisplayName\00\01\00\00\00\1E\00\00\00\CE\A5\CF\80\CE\B7\CF\81\CE\B5\CF\83\CE\AF\CE\B1 IntelliMirror\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2400\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2400\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1740\00"
+data(138) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1740\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00G\00\00\00CN=NetServices,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::YqWyU+sYDEO2qF6xvgncFg==\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::YqWyU+sYDEO2qF6xvgncFg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=server-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2300\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2300\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=licensingSiteSettings-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1663\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1663\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=6b800a81-affe-4a15-8e41-6ea0c7aa89e4,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::GLre0NwmWE67Y0lo3ieyzg==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::GLre0NwmWE67Y0lo3ieyzg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2323\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2323\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=msCOM-PartitionSet-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2246\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2246\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTFRSMember-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2169\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2169\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=volume-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=CONTACT-DISPLAY,CN=419,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(4742) = "g\19\01&\14\00\00\00CN=contact-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00contact-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002334\00uSNChanged\00\01\00\00\00\04\00\00\002334\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00contact-Display\00objectGUID\00\01\00\00\00\10\00\00\00\D8*\DC\9CJ\BB.I\B8\AE\F3\9D>q\BE\92\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00&\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\09\00\00\00\00\00\00\1E\09\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\005,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{c5f1645c-c8c9-11d0-bcdb-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f0-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0E\00\00\00\D0\9A\D0\BE\D0\BD\D1\82\D0\B0\D0\BA\D1\82\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\007\00\00\00=\00\00\00wWWHomePage,\D0\90\D0\B4\D1\80\D0\B5\D1\81 \D1\81\D1\82\D1\80\D0\B0\D0\BD\D0\B8\D1\86\D1\8B \D0\B2 \D0\98\D0\BD\D1\82\D0\B5\D1\80\D0\BD\D0\B5\D1\82\D0\B5\00D\00\00\00url,\D0\90\D0\B4\D1\80\D0\B5\D1\81 \D1\81\D1\82\D1\80\D0\B0\D0\BD\D0\B8\D1\86\D1\8B \D0\B2 \D0\98\D0\BD\D1\82\D0\B5\D1\80\D0\BD\D0\B5\D1\82\D0\B5 (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00\18\00\00\00title,\D0\94\D0\BE\D0\BB\D0\B6\D0\BD\D0\BE\D1\81\D1\82\D1\8C\004\00\00\00telexNumber,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\82\D0\B5\D0\BB\D0\B5\D0\BA\D1\81\D0\B0 (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00+\00\00\00telephoneNumber,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\82\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD\D0\B0\00$\00\00\00streetAddress,\D0\90\D0\B4\D1\80\D0\B5\D1\81, \D1\83\D0\BB\D0\B8\D1\86\D0\B0\00\11\00\00\00st,\D0\9E\D0\B1\D0\BB\D0\B0\D1\81\D1\82\D1\8C\00\11\00\00\00sn,\D0\A4\D0\B0\D0\BC\D0\B8\D0\BB\D0\B8\D1\8F\00,\00\00\00primaryTelexNumber,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\82\D0\B5\D0\BB\D0\B5\D0\BA\D1\81\D0\B0\00I\00\00\00primaryInternationalISDNNumber,\D0\9C\D0\B5\D0\B6\D0\B4\D1\83\D0\BD\D0\B0\D1\80\D0\BE\D0\B4\D0\BD\D1\8B\D0\B9 \D0\BD\D0\BE\D0\BC\D0\B5\D1\80 ISDN\00'\00\00\00postOfficeBox,\D0\9F\D0\BE\D1\87\D1\82\D0\BE\D0\B2\D1\8B\D0\B9 \D1\8F\D1\89\D0\B8\D0\BA\00(\00\00\00postalCode,\D0\9F\D0\BE\D1\87\D1\82\D0\BE\D0\B2\D1\8B\D0\B9 \D0\B8\D0\BD\D0\B4\D0\B5\D0\BA\D1\81\00)\00\00\00physicalDeliveryOfficeName,\D0\9A\D0\BE\D0\BC\D0\BD\D0\B0\D1\82\D0\B0\00&\00\00\00personalTitle,\D0\A2\D0\B8\D1\82\D1\83\D0\BB, \D0\B7\D0\B2\D0\B0\D0\BD\D0\B8\D0\B5\00!\00\00\00pager,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D0\BF\D0\B5\D0\B9\D0\B4\D0\B6\D0\B5\D1\80\D0\B0\009\00\00\00otherTelephone,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\82\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD\D0\B0 (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\005\00\00\00otherPager,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D0\BF\D0\B5\D0\B9\D0\B4\D0\B6\D0\B5\D1\80\D0\B0 (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00G\00\00\00otherMobile,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\81\D0\BE\D1\82\D0\BE\D0\B2\D0\BE\D0\B3\D0\BE \D1\82\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD\D0\B0 (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00=\00\00\00otherMailbox,\D0\AD\D0\BB\D0\B5\D0\BA\D1\82\D1\80\D0\BE\D0\BD\D0\BD\D0\B0\D1\8F \D0\BF\D0\BE\D1\87\D1\82\D0\B0 (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00>\00\00\00otherIpPhone,\D0\A2\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD\D0\BD\D1\8B\D0\B9 \D0\BD\D0\BE\D0\BC\D0\B5\D1\80 IP (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00=\00\00\00otherHomePhone,\D0\94\D0\BE\D0\BC\D0\B0\D1\88\D0\BD\D0\B8\D0\B9 \D1\82\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00B\00\00\00otherFacsimileTelephoneNumber,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\84\D0\B0\D0\BA\D1\81\D0\B0 (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\003\00\00\00mSDS-PhoneticDepartment,\D0\9E\D1\82\D0\B4\D0\B5\D0\BB \D1\84\D0\BE\D0\BD\D0\B5\D1\82\D0\B8\D0\BA\D0\B8\00B\00\00\00mSDS-PhoneticCompanyName,\D0\9E\D1\80\D0\B3\D0\B0\D0\BD\D0\B8\D0\B7\D0\B0\D1\86\D0\B8\D1\8F (\D1\84\D0\BE\D0\BD\D0\B5\D1\82\D0\B8\D0\BA\D0\B0)\00S\00\00\00mSDS-PhoneticDisplayName,\D0\9E\D1\82\D0\BE\D0\B1\D1\80\D0\B0\D0\B6\D0\B0\D0\B5\D0\BC\D0\BE\D0\B5 \D0\B8\D0\BC\D1\8F (\D0\BF\D1\80\D0\BE\D0\B8\D0\B7\D0\BD\D0\BE\D1\88\D0\B5\D0\BD\D0\B8\D0\B5)\007\00\00\00mSDS-PhoneticLastName,\D0\A4\D0\B0\D0\BC\D0\B8\D0\BB\D0\B8\D1\8F (\D1\84\D0\BE\D0\BD\D0\B5\D1\82\D0\B8\D0\BA\D0\B0)\000\00\00\00mSDS-PhoneticFirstName,\D0\98\D0\BC\D1\8F (\D1\84\D0\BE\D0\BD\D0\B5\D1\82\D0\B8\D0\BA\D0\B0)\003\00\00\00mobile,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\81\D0\BE\D1\82\D0\BE\D0\B2\D0\BE\D0\B3\D0\BE \D1\82\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD\D0\B0\00A\00\00\00middleName,\D0\A1\D1\80\D0\B5\D0\B4\D0\BD\D1\8F\D1\8F \D1\87\D0\B0\D1\81\D1\82\D1\8C \D0\B8\D0\BC\D0\B5\D0\BD\D0\B8, \D0\BE\D1\82\D1\87\D0\B5\D1\81\D1\82\D0\B2\D0\BE\00\1C\00\00\00memberOf,\D0\A7\D0\BB\D0\B5\D0\BD \D0\B3\D1\80\D1\83\D0\BF\D0\BF\00 \00\00\00manager,\D0\A0\D1\83\D0\BA\D0\BE\D0\B2\D0\BE\D0\B4\D0\B8\D1\82\D0\B5\D0\BB\D1\8C\00&\00\00\00mail,\D0\AD\D0\BB\D0\B5\D0\BA\D1\82\D1\80\D0\BE\D0\BD\D0\BD\D0\B0\D1\8F \D0\BF\D0\BE\D1\87\D1\82\D0\B0\00\0C\00\00\00l,\D0\93\D0\BE\D1\80\D0\BE\D0\B4\00*\00\00\00ipPhone,\D0\A2\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD\D0\BD\D1\8B\D0\B9 \D0\BD\D0\BE\D0\BC\D0\B5\D1\80 IP\00Q\00\00\00internationalISDNNumber,\D0\9C\D0\B5\D0\B6\D0\B4\D1\83\D0\BD\D0\B0\D1\80\D0\BE\D0\B4\D0\BD\D1\8B\D0\B9 \D0\BD\D0\BE\D0\BC\D0\B5\D1\80 ISDN (\D0\BF\D1\80\D0\BE\D1\87\D0\B8\D0\B5)\00\19\00\00\00info,\D0\9F\D1\80\D0\B8\D0\BC\D0\B5\D1\87\D0\B0\D0\BD\D0\B8\D1\8F\00\19\00\00\00initials,\D0\98\D0\BD\D0\B8\D1\86\D0\B8\D0\B0\D0\BB\D1\8B\00-\00\00\00homePostalAddress,\D0\94\D0\BE\D0\BC\D0\B0\D1\88\D0\BD\D0\B8\D0\B9 \D0\B0\D0\B4\D1\80\D0\B5\D1\81\00)\00\00\00homePhone,\D0\94\D0\BE\D0\BC\D0\B0\D1\88\D0\BD\D0\B8\D0\B9 \D1\82\D0\B5\D0\BB\D0\B5\D1\84\D0\BE\D0\BD\00\10\00\00\00givenName,\D0\98\D0\BC\D1\8F\005\00\00\00generationQualifier,\D0\A1\D1\83\D1\84\D1\84\D0\B8\D0\BA\D1\81 \D0\BF\D0\BE\D0\BA\D0\BE\D0\BB\D0\B5\D0\BD\D0\B8\D1\8F\00.\00\00\00facsimileTelephoneNumber,\D0\9D\D0\BE\D0\BC\D0\B5\D1\80 \D1\84\D0\B0\D0\BA\D1\81\D0\B0\00&\00\00\00employeeID,\D0\9A\D0\BE\D0\B4 \D1\81\D0\BE\D1\82\D1\80\D1\83\D0\B4\D0\BD\D0\B8\D0\BA\D0\B0\00\13\00\00\00division,\D0\9E\D1\82\D0\B4\D0\B5\D0\BB\003\00\00\00distinguishedName,\D0\A0\D0\B0\D0\B7\D0\BB\D0\B8\D1\87\D0\B0\D1\8E\D1\89\D0\B5\D0\B5\D1\81\D1\8F \D0\B8\D0\BC\D1\8F\00%\00\00\00displayName,\D0\92\D1\8B\D0\B2\D0\BE\D0\B4\D0\B8\D0\BC\D0\BE\D0\B5 \D0\B8\D0\BC\D1\8F\001\00\00\00directReports,\D0\9F\D1\80\D1\8F\D0\BC\D1\8B\D0\B5 \D0\BF\D0\BE\D0\B4\D1\87\D0\B8\D0\BD\D0\B5\D0\BD\D0\BD\D1\8B\D0\B5\00\1C\00\00\00description,\D0\9E\D0\BF\D0\B8\D1\81\D0\B0\D0\BD\D0\B8\D0\B5\00\15\00\00\00department,\D0\9E\D1\82\D0\B4\D0\B5\D0\BB\00\1E\00\00\00company,\D0\9E\D1\80\D0\B3\D0\B0\D0\BD\D0\B8\D0\B7\D0\B0\D1\86\D0\B8\D1\8F\00\1E\00\00\00comment,\D0\9A\D0\BE\D0\BC\D0\BC\D0\B5\D0\BD\D1\82\D0\B0\D1\80\D0\B8\D0\B9\00\16\00\00\00cn,\D0\9F\D0\BE\D0\BB\D0\BD\D0\BE\D0\B5 \D0\B8\D0\BC\D1\8F\00\0F\00\00\00co,\D0\A1\D1\82\D1\80\D0\B0\D0\BD\D0\B0\00<\00\00\00c,\D0\A1\D0\BE\D0\BA\D1\80\D0\B0\D1\89\D0\B5\D0\BD\D0\BD\D0\BE\D0\B5 \D0\BE\D0\B1\D0\BE\D0\B7\D0\BD\D0\B0\D1\87\D0\B5\D0\BD\D0\B8\D0\B5 \D1\81\D1\82\D1\80\D0\B0\D0\BD\D1\8B\00\1A\00\00\00assistant,\D0\9F\D0\BE\D0\BC\D0\BE\D1\89\D0\BD\D0\B8\D0\BA\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(37) = "DN=@INDEX:CN:DS-CHECK-STALE-PHANTOMS\00"
+data(168) = "g\19\01&\02\00\00\00@INDEX:CN:DS-CHECK-STALE-PHANTOMS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=DS-Check-Stale-Phantoms,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2945\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2945\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::jmzopm9o7UKpX4klNekxjw==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::jmzopm9o7UKpX4klNekxjw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::+Yst4FnrcEW3atc/KyOgMw==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::+Yst4FnrcEW3atc/KyOgMw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTDSService-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=INTELLIMIRRORGROUP-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1614) = "g\19\01&\10\00\00\00CN=IntellimirrorGroup-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1A\00\00\00IntellimirrorGroup-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002833\00uSNChanged\00\01\00\00\00\04\00\00\002833\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1A\00\00\00IntellimirrorGroup-Display\00objectGUID\00\01\00\00\00\10\00\00\00\8F\1B\D9.c\A2\84H\BFdN\13P\DC\8A\A6\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\11\0B\00\00\00\00\00\00\11\0B\00\00\00\00\00\00\00adminPropertyPages\00\02\00\00\00(\00\00\002,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{C641CF88-892F-11d1-BBEB-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{C641CF88-892F-11d1-BBEB-0060081692B3}\00classDisplayName\00\01\00\00\00\13\00\00\00IntelliMirror Group\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2671\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2671\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=domainPolicy-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2594\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2594\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2707\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2707\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=sitesContainer-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::RyZIJL16UEqwS4OPfjL81Q==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::RyZIJL16UEqwS4OPfjL81Q==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(109) = "DN=CN=MSMQ-CUSTOM-RECIPIENT-DISPLAY,CN=404,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2011) = "g\19\01&\13\00\00\00CN=msMQ-Custom-Recipient-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1D\00\00\00msMQ-Custom-Recipient-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002536\00uSNChanged\00\01\00\00\00\04\00\00\002536\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1D\00\00\00msMQ-Custom-Recipient-Display\00objectGUID\00\01\00\00\00\10\00\00\003\1C\97u\15\AAw@\86{@\E4ki\11\1E\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\F2\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E8\09\00\00\00\00\00\00\E8\09\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-437\00creationWizard\00\01\00\00\00&\00\00\00{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\001,{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00classDisplayName\00\01\00\00\00\11\00\00\00MSMQ \E4\BD\87\E5\88\97\E5\88\A5\E5\90\8D\00adminContextMenu\00\01\00\00\00(\00\00\001,{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00attributeDisplayNames\00\03\00\00\00&\00\00\00msMQ-Recipient-FormatName,\E6\A0\BC\E5\BC\8F\E5\90\8D\E7\A8\B1\00\12\00\00\00description,\E6\8F\8F\E8\BF\B0\00\09\00\00\00cn,\E5\90\8D\E7\A8\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(43) = "DN=@INDEX:CN:MSMQ-RECEIVE-COMPUTER-JOURNAL\00"
+data(180) = "g\19\01&\02\00\00\00@INDEX:CN:MSMQ-RECEIVE-COMPUTER-JOURNAL\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=msmq-Receive-computer-Journal,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(40) = "DN=@INDEX:CN:INTERSITETRANSPORT-DISPLAY\00"
+data(2751) = "g\19\01&\02\00\00\00@INDEX:CN:INTERSITETRANSPORT-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=CONTACT-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(3857) = "g\19\01&\14\00\00\00CN=contact-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00contact-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002838\00uSNChanged\00\01\00\00\00\04\00\00\002838\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00contact-Display\00objectGUID\00\01\00\00\00\10\00\00\006\C9N\0EM\02`A\B2O\9C^x'\EB\CD\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\16\0B\00\00\00\00\00\00\16\0B\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\005,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{c5f1645c-c8c9-11d0-bcdb-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f0-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\07\00\00\00Contact\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\007\00\00\00\1C\00\00\00wWWHomePage,Web Page Address\00\1D\00\00\00url,Web Page Address (Others)\00\0F\00\00\00title,Job Title\00!\00\00\00telexNumber,Telex Number (Others)\00 \00\00\00telephoneNumber,Telephone Number\00\1C\00\00\00streetAddress,Street Address\00\11\00\00\00st,State/Province\00\0C\00\00\00sn,Last Name\00\1F\00\00\00primaryTelexNumber,Telex Number\008\00\00\00primaryInternationalISDNNumber,International ISDN Number\00\1D\00\00\00postOfficeBox,Post Office Box\00\1A\00\00\00postalCode,ZIP/Postal Code\00*\00\00\00physicalDeliveryOfficeName,Office Location\00\13\00\00\00personalTitle,Title\00\12\00\00\00pager,Pager Number\00$\00\00\00otherTelephone,Phone Number (Others)\00 \00\00\00otherPager,Pager Number (Others)\00\22\00\00\00otherMobile,Mobile Number (Others)\00$\00\00\00otherMailbox,E-Mail Address (Others)\00%\00\00\00otherIpPhone,IP Phone Number (Others)\00)\00\00\00otherHomePhone,Home Phone Number (Others)\001\00\00\00otherFacsimileTelephoneNumber,Fax Number (Others)\00+\00\00\00mSDS-PhoneticDepartment,Phonetic Department\00.\00\00\00mSDS-PhoneticCompanyName,Phonetic Company Name\00.\00\00\00mSDS-PhoneticDisplayName,Phonetic Display Name\00(\00\00\00mSDS-PhoneticLastName,Phonetic Last Name\00*\00\00\00mSDS-PhoneticFirstName,Phonetic First Name\00\14\00\00\00mobile,Mobile Number\00\16\00\00\00middleName,Middle Name\00\12\00\00\00memberOf,Member Of\00\0F\00\00\00manager,Manager\00\13\00\00\00mail,E-Mail Address\00\06\00\00\00l,City\00\17\00\00\00ipPhone,IP Phone Number\00:\00\00\00internationalISDNNumber,International ISDN Number (Others)\00\0A\00\00\00info,Notes\00\11\00\00\00initials,Initials\00\1E\00\00\00homePostalAddress,Home Address\00\14\00\00\00homePhone,Home Phone\00\14\00\00\00givenName,First Name\00'\00\00\00generationQualifier,Generational Suffix\00#\00\00\00facsimileTelephoneNumber,Fax Number\00\16\00\00\00employeeID,Employee ID\00\11\00\00\00division,Division\00$\00\00\00distinguishedName,Distinguished Name\00\18\00\00\00displayName,Display Name\00\1C\00\00\00directReports,Direct Reports\00\17\00\00\00description,Description\00\15\00\00\00department,Department\00\0F\00\00\00company,Company\00\0F\00\00\00comment,Comment\00\07\00\00\00cn,Name\00\0A\00\00\00co,Country\00\16\00\00\00c,Country Abbreviation\00\13\00\00\00assistant,Assistant\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::C8o90yUKTk+JeXHoneyNZQ==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::C8o90yUKTk+JeXHoneyNZQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=inetOrgPerson-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2978\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2978\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=default-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=@INDEX:@IDXONE:CN=DIRECTORY SERVICE,CN=WINDOWS NT,CN=SERVICES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(377) = "g\19\01&\02\00\00\00@INDEX:@IDXONE:CN=DIRECTORY SERVICE,CN=WINDOWS NT,CN=SERVICES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\02\00\00\00p\00\00\00CN=Optional Features,CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00m\00\00\00CN=Query-Policies,CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(35) = "DN=@INDEX:CN:ACTIVEDIRECTORYUPDATE\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:CN:ACTIVEDIRECTORYUPDATE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00V\00\00\00CN=ActiveDirectoryUpdate,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2781\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2781\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=SITELINKBRIDGE-DISPLAY,CN=416,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1692) = "g\19\01&\10\00\00\00CN=siteLinkBridge-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\16\00\00\00siteLinkBridge-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001794\00uSNChanged\00\01\00\00\00\04\00\00\001794\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00siteLinkBridge-Display\00objectGUID\00\01\00\00\00\10\00\00\00F\94\AD\DF\06`xH\94\96\D2n\CE\14\8D\9C\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\02\07\00\00\00\00\00\00\02\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30562-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\15\00\00\00Ponte de Link de Site\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::IIUqvkkEjkiPI2chgsx0KA==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::IIUqvkkEjkiPI2chgsx0KA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=nTDSConnection-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1615\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1615\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=Validated-DNS-Host-Name,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(99) = "DN=CN=NTFRSMEMBER-DISPLAY,CN=419,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1674) = "g\19\01&\10\00\00\00CN=nTFRSMember-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\13\00\00\00nTFRSMember-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002358\00uSNChanged\00\01\00\00\00\04\00\00\002358\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00nTFRSMember-Display\00objectGUID\00\01\00\00\00\10\00\00\00m|\FBo\B2{?M\9C\D9\88M\8C\0B\EE\00\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC6\09\00\00\00\00\00\006\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{9da6fd6a-c63b-11d0-b94d-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\0C\00\00\00\D0\A7\D0\BB\D0\B5\D0\BD FRS\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1638\00"
+data(144) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1638\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00M\00\00\00CN=Receive-As,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::oP0FhYFCckGME0GeVEVg8w==\00"
+data(193) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::oP0FhYFCckGME0GeVEVg8w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(91) = "DN=CN=DIALUP,CN=WELLKNOWN SECURITY PRINCIPALS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1769) = "g\19\01&\0E\00\00\00CN=Dialup,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\18\00\00\00foreignSecurityPrincipal\00cn\00\01\00\00\00\06\00\00\00Dialup\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171917.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171917.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003357\00uSNChanged\00\01\00\00\00\04\00\00\003357\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\CC\02\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\80\02\12\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\18\00\FF\01\0F\00\01\02\00\00\00\00\00\05 \00\00\00$\02\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00T\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00V\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B2\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\00\00\14\00\00\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00B/\BAY\A2y\D0\11\90 \00\C0O\C2\D3\CF\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00T\01\8D\E4\F8\BC\D1\11\87\02\00\C0O\B9`P\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\01\00\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\06\00\00\00Dialup\00objectGUID\00\01\00\00\00\10\00\00\00\0B\17Q\B7\0E\DF1@\96)\7F \F9\8B\F8\A2\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\01\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\02\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\19\01\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\01\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\92\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\03\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1D\0D\00\00\00\00\00\00\1D\0D\00\00\00\00\00\00\00objectSid\00\01\00\00\00\0C\00\00\00\01\01\00\00\00\00\00\05\01\00\00\00\00objectCategory\00\01\00\00\00T\00\00\00CN=Foreign-Security-Principal,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2700\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2700\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2623\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2623\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=nTDSSettings-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1986\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1986\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2546\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2546\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=pKICertificateTemplate-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::QU+OFQOexEuX+yGZCBf4GQ==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::QU+OFQOexEuX+yGZCBf4GQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2272\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2272\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-UI-Default-Settings,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::QORMvNZxvk6U2w9TKl962g==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::QORMvNZxvk6U2w9TKl962g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2195\00"
+data(168) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2195\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2308\00"
+data(173) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2308\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=613BD063-E8E9-4A62-8F4C-CDA566F7EB6F,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=613bd063-e8e9-4a62-8f4c-cda566f7eb6f,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\00613bd063-e8e9-4a62-8f4c-cda566f7eb6f\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001713\00uSNChanged\00\01\00\00\00\04\00\00\001713\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\00613bd063-e8e9-4a62-8f4c-cda566f7eb6f\00objectGUID\00\01\00\00\00\10\00\00\00\817\DDs\CDx+K\97\92#P\C0\14\87K\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B1\06\00\00\00\00\00\00\B1\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=INTELLIMIRRORSCP-DISPLAY,CN=407,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1699) = "g\19\01&\10\00\00\00CN=IntellimirrorSCP-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001994\00uSNChanged\00\01\00\00\00\04\00\00\001994\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00objectGUID\00\01\00\00\00\10\00\00\00\F9\0D\00\14\F7\96\AAM\A8\95\88?\AD\86\B7|\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CA\07\00\00\00\00\00\00\CA\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4e40f770-369c-11d0-8922-00a024ab2dbb}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00classDisplayName\00\01\00\00\00\14\00\00\00IntelliMirror-Dienst\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2810\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2810\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=07E57D28-AD40-44FC-8334-8A0DC119B3F4,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=07e57d28-ad40-44fc-8334-8a0dc119b3f4,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\0007e57d28-ad40-44fc-8334-8a0dc119b3f4\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001701\00uSNChanged\00\01\00\00\00\04\00\00\001701\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\0007e57d28-ad40-44fc-8334-8a0dc119b3f4\00objectGUID\00\01\00\00\00\10\00\00\00]\FF\C7\E3\B7u\CFA\A4\C2g\D1\FCm\05.\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A5\06\00\00\00\00\00\00\A5\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2733\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2733\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=site-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Kimo5vyqKUGPGqIXmrBepA==\00"
+data(189) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Kimo5vyqKUGPGqIXmrBepA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2656\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2656\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=queryPolicy-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(29) = "DN=@INDEX:NAME:VALIDATED-SPN\00"
+data(150) = "g\19\01&\02\00\00\00@INDEX:NAME:VALIDATED-SPN\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00P\00\00\00CN=Validated-SPN,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2579\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2579\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2382\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2382\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=inetOrgPerson-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Fqpr/pm3A0ym9LmhkJr96g==\00"
+data(193) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Fqpr/pm3A0ym9LmhkJr96g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::lqOKr8XsH02a2BEuSVGBzA==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::lqOKr8XsH02a2BEuSVGBzA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-UI-Default-Settings,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=MSMQENTERPRISESETTINGS-DISPLAY,CN=41D,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1791) = "g\19\01&\11\00\00\00CN=mSMQEnterpriseSettings-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00mSMQEnterpriseSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002700\00uSNChanged\00\01\00\00\00\04\00\00\002700\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00mSMQEnterpriseSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00\03qt\083\C4|J\A6\8B\AA\09\9Cc2\D7\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0A\00\00\00\00\00\00\8C\0A\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-253\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{2E4B37AB-CC8B-11D1-9C85-006008764D0E}\00classDisplayName\00\01\00\00\00\0D\00\00\00MSMQ-f\C3\B6retag\00adminContextMenu\00\01\00\00\00(\00\00\001,{2E4B37AB-CC8B-11D1-9C85-006008764D0E}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=NTDSSITESETTINGS-DISPLAY,CN=405,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1694) = "g\19\01&\10\00\00\00CN=nTDSSiteSettings-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00nTDSSiteSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002805\00uSNChanged\00\01\00\00\00\04\00\00\002805\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00nTDSSiteSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00p?Y\09\07\E4:C\BB\C2\F1\A7u\B8a\9A\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\F5\0A\00\00\00\00\00\00\F5\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{2f280288-bb6d-11d0-b948-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\11\00\00\00Nastaven\C3\AD s\C3\ADt\C4\9B\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(98) = "DN=CN=PRINTQUEUE-DISPLAY,CN=40B,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2894) = "g\19\01&\13\00\00\00CN=printQueue-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\12\00\00\00printQueue-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002966\00uSNChanged\00\01\00\00\00\04\00\00\002966\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\12\00\00\00printQueue-Display\00objectGUID\00\01\00\00\00\10\00\00\00\8DK\BDQ\22\0D\AAI\BF\19\88\DCH}\DD\D7\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\96\0B\00\00\00\00\00\00\96\0B\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6493-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f5-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\08\00\00\00Tulostin\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\1B\00\00\00\1D\00\00\00versionNumber,Objektin versio\00\16\00\00\00url,Verkkosivun osoite\00\17\00\00\00serverName,Palvelinnimi\00%\00\00\00printStaplingSupported,Tukee nidontaa\00\17\00\00\00printShareName,Jakonimi\00%\00\00\00printPagesPerMinute,Sivuja minuutissa\00\1C\00\00\00printRateUnit,Nopeusyksik\C3\B6t\00\10\00\00\00printRate,Nopeus\00\19\00\00\00printOwner,Omistajan nimi\00\1C\00\00\00printMemory,Asennettu muisti\00'\00\00\00printMediaSupported,Tuetut paperityypit\00/\00\00\00printMediaReady,K\C3\A4ytett\C3\A4viss\C3\A4 olevat paperit\00-\00\00\00printMaxResolutionSupported,Enimm\C3\A4istarkkuus\00\1B\00\00\00printLanguage,Tulostuskieli\00\10\00\00\00printerName,Nimi\005\00\00\00printDuplexSupported,Tukee kaksipuolista tulostamista\00\22\00\00\00printColor,Tukee v\C3\A4ritulostamista\00\1D\00\00\00printCollate,Tukee lajittelua\00\1D\00\00\00printBinNames,Sy\C3\B6tt\C3\B6lokerot\00\0F\00\00\00portName,Portti\00\11\00\00\00location,Sijainti\00\10\00\00\00driverName,Malli\00\15\00\00\00description,Kommentti\00\1A\00\00\00contactName,Yhteyshenkil\C3\B6\00\19\00\00\00assetNumber,Kalustonumero\00\12\00\00\00uNCName,Verkkonimi\00\17\00\00\00cn,Hakemistopalvelunimi\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(68) = "DN=@INDEX:DISPLAYNAME:REPLICATING DIRECTORY CHANGES IN FILTERED SET\00"
+data(218) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:REPLICATING DIRECTORY CHANGES IN FILTERED SET\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=DS-Replication-Get-Changes-In-Filtered-Set,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::aUVjTIseekORv3/O1LSfsA==\00"
+data(203) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::aUVjTIseekORv3/O1LSfsA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=94fdebc6-8eeb-4640-80de-ec52b9ca17fa,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1938\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1938\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=IntellimirrorSCP-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::zK10MAhH/0aWEn0FIAyq/w==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::zK10MAhH/0aWEn0FIAyq/w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=siteLinkBridge-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(68) = "DN=@INDEX:DISPLAYNAME:ENABLE PER USER REVERSIBLY ENCRYPTED PASSWORD\00"
+data(221) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:ENABLE PER USER REVERSIBLY ENCRYPTED PASSWORD\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00p\00\00\00CN=Enable-Per-User-Reversibly-Encrypted-Password,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1741\00"
+data(146) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1741\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00O\00\00\00CN=Public Key Services,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2301\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2301\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2224\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2224\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=localPolicy-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1664\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1664\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=dd07182c-3174-4c95-902a-d64fee285bbf,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=CONTAINER-DISPLAY,CN=C0A,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2143) = "g\19\01&\13\00\00\00CN=container-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00container-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002630\00uSNChanged\00\01\00\00\00\04\00\00\002630\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00container-Display\00objectGUID\00\01\00\00\00\10\00\00\00\8F6\F9?\04\DF+L\80uV7\93\0DM\F6\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCF\0A\00\00\00\00\00\00F\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{5a96f2d8-736e-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0A\00\00\00Contenedor\00adminContextMenu\00\04\00\00\00(\00\00\004,{AB790AA1-CDC1-478a-9351-B2E05CFCAD09}\00(\00\00\003,{EEBD2F15-87EE-4F93-856F-6AD7E31787B3}\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\02\00\00\00\18\00\00\00description,Descripci\C3\B3n\00\09\00\00\00cn,Nombre\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1587\00"
+data(130) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1587\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00?\00\00\00CN=Deleted Objects,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2147\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2147\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=sitesContainer-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::J96ouheZ6kyJxgTDu1cHCQ==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::J96ouheZ6kyJxgTDu1cHCQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(93) = "DN=CN=GROUP-DISPLAY,CN=413,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2545) = "g\19\01&\14\00\00\00CN=group-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0D\00\00\00group-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002556\00uSNChanged\00\01\00\00\00\04\00\00\002556\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0D\00\00\00group-Display\00objectGUID\00\01\00\00\00\10\00\00\00 T\AF\5C\9C\87\9EK\80\19>\DE]|i\A1\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\FC\09\00\00\00\00\00\00\FC\09\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\06\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{9a899a50-f96b-11d2-ac78-0008c7726cf7}\00(\00\00\004,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\003,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\002,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6489-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ee-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\05\00\00\00GROEP\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\0D\00\00\00\1D\00\00\00wWWHomePage,Adres van website\00\1F\00\00\00url,Adres van website (overige)\001\00\00\00samAccountName,Groepsnaam (van voor Windows 2000)\00)\00\00\00physicalDeliveryOfficeName,Kantoorlocatie\00\0D\00\00\00info,Notities\000\00\00\00mSDS-PhoneticDisplayName,Fonetische weergavenaam\00\0C\00\00\00member,Leden\00\16\00\00\00managedBy,Beheerd door\00\08\00\00\00l,Plaats\00\19\00\00\00distinguishedName,DN-naam\00\18\00\00\00description,Beschrijving\00\0F\00\00\00c,Landafkorting\00\07\00\00\00cn,Naam\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::SLVCUlLa90+HmAxHRKNITg==\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::SLVCUlLa90+HmAxHRKNITg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(24) = "DN=@INDEX:USNCREATED:15\00"
+data(109) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:15\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00,\00\00\00CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2608\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2608\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-UI-Default-Settings,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=MSMQENTERPRISESETTINGS-DISPLAY,CN=401,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1793) = "g\19\01&\11\00\00\00CN=mSMQEnterpriseSettings-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00mSMQEnterpriseSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002476\00uSNChanged\00\01\00\00\00\04\00\00\002476\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00mSMQEnterpriseSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00_\10d\E8\99\97\0DD\A5\B6\D6\C6\0F\90\D08\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\09\00\00\00\00\00\00\AC\09\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-253\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{2E4B37AB-CC8B-11D1-9C85-006008764D0E}\00classDisplayName\00\01\00\00\00\0F\00\00\00\D9\85\D8\B4\D8\B1\D9\88\D8\B9 MSMQ\00adminContextMenu\00\01\00\00\00(\00\00\001,{2E4B37AB-CC8B-11D1-9C85-006008764D0E}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2411\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2411\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::K+I/8qfd1kmwTVLMhcOeKg==\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::K+I/8qfd1kmwTVLMhcOeKg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2334\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2334\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1697\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1697\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=63c0f51a-067c-4640-8a4f-044fb33f1049,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2257\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2257\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(92) = "DN=CN=SERVICE,CN=WELLKNOWN SECURITY PRINCIPALS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1772) = "g\19\01&\0E\00\00\00CN=Service,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\18\00\00\00foreignSecurityPrincipal\00cn\00\01\00\00\00\07\00\00\00Service\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171917.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171917.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003374\00uSNChanged\00\01\00\00\00\04\00\00\003374\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\CC\02\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\80\02\12\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\18\00\FF\01\0F\00\01\02\00\00\00\00\00\05 \00\00\00$\02\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00T\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00V\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B2\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\00\00\14\00\00\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00B/\BAY\A2y\D0\11\90 \00\C0O\C2\D3\CF\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00T\01\8D\E4\F8\BC\D1\11\87\02\00\C0O\B9`P\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\01\00\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\07\00\00\00Service\00objectGUID\00\01\00\00\00\10\00\00\00\90\BC\7F\C2-A\9A@\ACXiv@\85\D5\DD\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\01\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\02\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\19\01\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\01\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\92\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\03\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC.\0D\00\00\00\00\00\00.\0D\00\00\00\00\00\00\00objectSid\00\01\00\00\00\0C\00\00\00\01\01\00\00\00\00\00\05\06\00\00\00\00objectCategory\00\01\00\00\00T\00\00\00CN=Foreign-Security-Principal,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=INTELLIMIRRORSCP-DISPLAY,CN=40C,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1700) = "g\19\01&\10\00\00\00CN=IntellimirrorSCP-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001826\00uSNChanged\00\01\00\00\00\04\00\00\001826\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00objectGUID\00\01\00\00\00\10\00\00\00\C6\A2|<\AB\B0\E1E\9D\01\86B\D2ueo\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\22\07\00\00\00\00\00\00\22\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4e40f770-369c-11d0-8922-00a024ab2dbb}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00classDisplayName\00\01\00\00\00\15\00\00\00Service IntelliMirror\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2979\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2979\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=DEFAULT-DISPLAY,CN=412,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(3185) = "g\19\01&\13\00\00\00CN=default-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00default-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001960\00uSNChanged\00\01\00\00\00\04\00\00\001960\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00default-Display\00objectGUID\00\01\00\00\00\10\00\00\00\CA\C5\03\19I\1E\94M\8BW\B1\CD}\BF\F55\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\97\06\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\A8\07\00\00\00\00\00\00\A8\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00adminContextMenu\00\01\00\00\00(\00\00\000,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\12\00\00\00description,\EC\84\A4\EB\AA\85\00\09\00\00\00cn,\EC\9D\B4\EB\A6\84\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00extraColumns\00\1B\00\00\005\00\00\00msds-PhoneticDepartment,\EB\B6\80\EC\84\9C(\ED\95\9C\EA\B8\80 \ED\91\9C\EA\B8\B0),0,100,0\00=\00\00\00msds-PhoneticCompanyName,\ED\9A\8C\EC\82\AC \EC\9D\B4\EB\A6\84(\ED\95\9C\EA\B8\80 \ED\91\9C\EA\B8\B0),0,100,0\000\00\00\00msds-PhoneticLastName,\EC\84\B1(\ED\95\9C\EA\B8\80 \ED\91\9C\EA\B8\B0),0,100,0\004\00\00\00msds-PhoneticFirstName,\EC\9D\B4\EB\A6\84(\ED\95\9C\EA\B8\80 \ED\91\9C\EA\B8\B0),0,100,0\00=\00\00\00msds-PhoneticDisplayName,\ED\91\9C\EC\8B\9C \EC\9D\B4\EB\A6\84(\ED\95\9C\EA\B8\80 \ED\91\9C\EA\B8\B0),0,100,0\00 \00\00\00postalCode,\EC\9A\B0\ED\8E\B8 \EB\B2\88\ED\98\B8,0,100,0\007\00\00\00textEncodedORAddress,X.400 \EC\A0\84\EC\9E\90 \EB\A9\94\EC\9D\BC \EC\A3\BC\EC\86\8C,0,130,0\004\00\00\00userPrincipalName,\EC\82\AC\EC\9A\A9\EC\9E\90 \EB\A1\9C\EA\B7\B8\EC\98\A8 \EC\9D\B4\EB\A6\84,0,200,0\00\14\00\00\00title,\EC\A7\81\ED\95\A8,0,100,0\00#\00\00\00targetAddress,\EB\8C\80\EC\83\81 \EC\A3\BC\EC\86\8C,0,100,0\00\11\00\00\00st,\EC\83\81\ED\83\9C,0,100,0\00,\00\00\00physicalDeliveryOfficeName,\EC\82\AC\EB\AC\B4\EC\8B\A4,0,100,0\00$\00\00\00whenChanged,\EC\88\98\EC\A0\95\ED\95\9C \EB\82\A0\EC\A7\9C,0,130,0\00\0E\00\00\00sn,\EC\84\B1,0,100,0\00:\00\00\00msExchIMMetaPhysicalURL,\EC\9D\B8\EC\8A\A4\ED\84\B4\ED\8A\B8 \EB\A9\94\EC\8B\9C\EC\A7\95 URL,0,140,0\00=\00\00\00msExchIMPhysicalURL,\EC\9D\B8\EC\8A\A4\ED\84\B4\ED\8A\B8 \EB\A9\94\EC\8B\9C\EC\A7\95 \ED\99\88 \EC\84\9C\EB\B2\84,0,170,0\00\18\00\00\00givenName,\EC\9D\B4\EB\A6\84,0,100,0\00,\00\00\00homeMDB,Exchange \EC\82\AC\EC\84\9C\ED\95\A8 \EC\A0\80\EC\9E\A5\EC\86\8C,0,100,0\00$\00\00\00mailNickname,Exchange \EB\B3\84\EC\B9\AD,0,175,0\00!\00\00\00mail,\EC\A0\84\EC\9E\90 \EB\A9\94\EC\9D\BC \EC\A3\BC\EC\86\8C,0,100,0\00B\00\00\00sAMAccountName,Windows 2000 \EC\9D\B4\EC\A0\84 \EB\B2\84\EC\A0\84 \EB\A1\9C\EA\B7\B8\EC\98\A8 \EC\9D\B4\EB\A6\84,0,120,0\00!\00\00\00displayName,\ED\91\9C\EC\8B\9C \EC\9D\B4\EB\A6\84,0,100,0\00\19\00\00\00department,\EB\B6\80\EC\84\9C,0,150,0\00\0F\00\00\00c,\EA\B5\AD\EA\B0\80,0,-1,0\00\16\00\00\00company,\ED\9A\8C\EC\82\AC,0,150,0\00\15\00\00\00l,\EA\B5\AC/\EA\B5\B0/\EC\8B\9C,0,150,0\00%\00\00\00telephoneNumber,\ED\9A\8C\EC\82\AC \EC\A0\84\ED\99\94,0,100,0\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30563-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::qgfgts13yUeuFiCvYjjIcQ==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::qgfgts13yUeuFiCvYjjIcQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2682\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2682\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=nTDSDSA-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::4pmH920yIkyCXzFY2FExBA==\00"
+data(187) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::4pmH920yIkyCXzFY2FExBA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSSubscriber-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1616\00"
+data(147) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1616\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00P\00\00\00CN=Validated-SPN,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(34) = "DN=@INDEX:NAME:MSMQ-GROUP-DISPLAY\00"
+data(2545) = "g\19\01&\02\00\00\00@INDEX:NAME:MSMQ-GROUP-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::k7PxT8RLNUaKyGeJwQywyA==\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::k7PxT8RLNUaKyGeJwQywyA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(52) = "DN=@INDEX:NAME:0FC5A978-0059-4B0A-9DC2-9896E8E389A1\00"
+data(208) = "g\19\01&\02\00\00\00@INDEX:NAME:0FC5A978-0059-4B0A-9DC2-9896E8E389A1\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=0fc5a978-0059-4b0a-9dc2-9896e8e389a1,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::n2Rt3kBNBkGsysjgBw2i0Q==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::n2Rt3kBNBkGsysjgBw2i0Q==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=inetOrgPerson-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(93) = "DN=@INDEX:OBJECTCATEGORY:CN=SITE-LINK,CN=SCHEMA,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(239) = "g\19\01&\02\00\00\00@INDEX:OBJECTCATEGORY:CN=SITE-LINK,CN=SCHEMA,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=DEFAULTIPSITELINK,CN=IP,CN=Inter-Site Transports,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(40) = "DN=@INDEX:DISPLAYNAME:OPEN ADDRESS LIST\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:OPEN ADDRESS LIST\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00T\00\00\00CN=Open-Address-Book,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(106) = "DN=CN=ENROLLMENT SERVICES,CN=PUBLIC KEY SERVICES,CN=SERVICES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1215) = "g\19\01&\0D\00\00\00CN=Enrollment Services,CN=Public Key Services,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\13\00\00\00Enrollment Services\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001743\00uSNChanged\00\01\00\00\00\04\00\00\001743\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\13\00\00\00Enrollment Services\00objectGUID\00\01\00\00\00\10\00\00\00\0A\D9\FCj\C8\84CG\9D~\F5\CF\A6:U\8E\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\CF\06\00\00\00\00\00\00\CF\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=NTDSSITESETTINGS-DISPLAY,CN=404,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1692) = "g\19\01&\10\00\00\00CN=nTDSSiteSettings-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00nTDSSiteSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002525\00uSNChanged\00\01\00\00\00\04\00\00\002525\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00nTDSSiteSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00\CB\0CY\F0\FB{\0AK\A2Mu2\98\A6\BCy\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\DD\09\00\00\00\00\00\00\DD\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{2f280288-bb6d-11d0-b948-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\0F\00\00\00\E7\AB\99\E5\8F\B0\E8\A8\AD\E5\AE\9A\E5\80\BC\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(105) = "DN=@INDEX:OBJECTCATEGORY:CN=MS-DS-QUOTA-CONTAINER,CN=SCHEMA,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(205) = "g\19\01&\02\00\00\00@INDEX:OBJECTCATEGORY:CN=MS-DS-QUOTA-CONTAINER,CN=SCHEMA,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00;\00\00\00CN=NTDS Quotas,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1690\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1690\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=ccfae63a-7fb5-454c-83ab-0e8e1214974e,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1803\00"
+data(168) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1803\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1726\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1726\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=dcb3c95d-deb7-4c51-ad13-43a7d5d06fc7,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2209\00"
+data(175) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2209\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1649\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1649\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=DS-Replication-Get-Changes,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(29) = "DN=@INDEX:OBJECTCLASS:SERVER\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:OBJECTCLASS:SERVER\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=ARES,CN=Servers,CN=Default-First-Site-Name,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2012\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2012\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=subnet-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(76) = "DN=CN=404,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1153) = "g\19\01&\0D\00\00\00CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00\03\00\00\00404\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002495\00uSNChanged\00\01\00\00\00\04\00\00\002495\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\03\00\00\00404\00objectGUID\00\01\00\00\00\10\00\00\00rx\90\99\AC$\F5G\81\DE\FF\05\EC\A1v\F2\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\BF\09\00\00\00\00\00\00\BF\09\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(56) = "DN=@INDEX:CN:DS-REPLICATION-GET-CHANGES-IN-FILTERED-SET\00"
+data(206) = "g\19\01&\02\00\00\00@INDEX:CN:DS-REPLICATION-GET-CHANGES-IN-FILTERED-SET\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=DS-Replication-Get-Changes-In-Filtered-Set,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(103) = "DN=CN=OTHER ORGANIZATION,CN=WELLKNOWN SECURITY PRINCIPALS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1805) = "g\19\01&\0E\00\00\00CN=Other Organization,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\18\00\00\00foreignSecurityPrincipal\00cn\00\01\00\00\00\12\00\00\00Other Organization\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171917.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171917.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003367\00uSNChanged\00\01\00\00\00\04\00\00\003367\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\CC\02\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\80\02\12\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\18\00\FF\01\0F\00\01\02\00\00\00\00\00\05 \00\00\00$\02\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00T\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00V\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B2\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\00\00\14\00\00\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00B/\BAY\A2y\D0\11\90 \00\C0O\C2\D3\CF\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00T\01\8D\E4\F8\BC\D1\11\87\02\00\C0O\B9`P\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\01\00\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\12\00\00\00Other Organization\00objectGUID\00\01\00\00\00\10\00\00\00Vr8\92\D6\DF\B5D\8E];\BBd\D0\E7/\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\01\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\02\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\19\01\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\01\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\92\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\03\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC'\0D\00\00\00\00\00\00'\0D\00\00\00\00\00\00\00objectSid\00\01\00\00\00\0C\00\00\00\01\01\00\00\00\00\00\05\E8\03\00\00\00objectCategory\00\01\00\00\00T\00\00\00CN=Foreign-Security-Principal,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2811\00"
+data(168) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2811\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00e\00\00\00CN=mSMQConfiguration-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(52) = "DN=@INDEX:DISPLAYNAME:REPLICATING DIRECTORY CHANGES\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:REPLICATING DIRECTORY CHANGES\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=DS-Replication-Get-Changes,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=NTDSSETTINGS-DISPLAY,CN=413,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1677) = "g\19\01&\10\00\00\00CN=nTDSSettings-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00nTDSSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002567\00uSNChanged\00\01\00\00\00\04\00\00\002567\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00nTDSSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\009\9A{\BB\CA\F7\BEO\84\BE\F3\0A\C4\A9\85\93\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\07\0A\00\00\00\00\00\00\07\0A\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{717EF4FB-AC8D-11D0-B945-00C04FD8D5B0}\00classDisplayName\00\01\00\00\00\0C\00\00\00Instellingen\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2734\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2734\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=server-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1997\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1997\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2657\00"
+data(175) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2657\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(40) = "DN=@INDEX:NAME:MSMQMIGRATEDUSER-DISPLAY\00"
+data(2701) = "g\19\01&\02\00\00\00@INDEX:NAME:MSMQMIGRATEDUSER-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00d\00\00\00CN=mSMQMigratedUser-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2360\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2360\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:3020\00"
+data(175) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:3020\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2283\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2283\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=computer-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(24) = "DN=@INDEX:NAME:EVERYONE\00"
+data(154) = "g\19\01&\02\00\00\00@INDEX:NAME:EVERYONE\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=Everyone,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::bInOazhxT0Gdf2CQYSvnTw==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::bInOazhxT0Gdf2CQYSvnTw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=782370CE-3D38-438D-8B0C-464220A3039D,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=782370ce-3d38-438d-8b0c-464220a3039d,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\00782370ce-3d38-438d-8b0c-464220a3039d\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001716\00uSNChanged\00\01\00\00\00\04\00\00\001716\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\00782370ce-3d38-438d-8b0c-464220a3039d\00objectGUID\00\01\00\00\00\10\00\00\00,\E0\FF\14\A8\FE'G\B2\FA\C9u\83\04\06\8F\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\B4\06\00\00\00\00\00\00\B4\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::RQ2Lp0rM40m8ffa27NTaSQ==\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::RQ2Lp0rM40m8ffa27NTaSQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(38) = "DN=@INDEX:NAME:DS-UI-DEFAULT-SETTINGS\00"
+data(2649) = "g\19\01&\02\00\00\00@INDEX:NAME:DS-UI-DEFAULT-SETTINGS\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00b\00\00\00CN=DS-UI-Default-Settings,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::O0WOdxowvk6jncY1eVAmSg==\00"
+data(188) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::O0WOdxowvk6jncY1eVAmSg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=nTDSSiteSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::QE8zsDYg8kmExc5bD8uygg==\00"
+data(203) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::QE8zsDYg8kmExc5bD8uygg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=eda27b49-e610-11d6-9793-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::xaFpPyTbrEqvVqEk04SSlQ==\00"
+data(178) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::xaFpPyTbrEqvVqEk04SSlQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=server-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=INTELLIMIRRORSCP-DISPLAY,CN=40B,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1700) = "g\19\01&\10\00\00\00CN=IntellimirrorSCP-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002956\00uSNChanged\00\01\00\00\00\04\00\00\002956\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00objectGUID\00\01\00\00\00\10\00\00\00\E6\89Ta\12\18|G\82 h'n\A8aM\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\8C\0B\00\00\00\00\00\00\8C\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4e40f770-369c-11d0-8922-00a024ab2dbb}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00classDisplayName\00\01\00\00\00\15\00\00\00IntelliMirror-palvelu\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::OXvqCqysNEa+1TE5Y71KKQ==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::OXvqCqysNEa+1TE5Y71KKQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=nTDSSettings-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::rhwMVfJfzEKlPO4Mam4KlQ==\00"
+data(180) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::rhwMVfJfzEKlPO4Mam4KlQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1642\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1642\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=User-Account-Restrictions,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(109) = "DN=CN=MSMQ-CUSTOM-RECIPIENT-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2012) = "g\19\01&\13\00\00\00CN=msMQ-Custom-Recipient-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1D\00\00\00msMQ-Custom-Recipient-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002872\00uSNChanged\00\01\00\00\00\04\00\00\002872\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1D\00\00\00msMQ-Custom-Recipient-Display\00objectGUID\00\01\00\00\00\10\00\00\00\85/~\E3V\D2\C5F\90e\BAV\07\C2w9\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\F2\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC8\0B\00\00\00\00\00\008\0B\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-437\00creationWizard\00\01\00\00\00&\00\00\00{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\001,{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00classDisplayName\00\01\00\00\00\10\00\00\00MSMQ Queue Alias\00adminContextMenu\00\01\00\00\00(\00\00\001,{9e4ab987-3cca-4de0-ae36-3d163df44d36}\00attributeDisplayNames\00\03\00\00\00%\00\00\00msMQ-Recipient-FormatName,Format Name\00\17\00\00\00description,Description\00\07\00\00\00cn,Name\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::dfsNtlpA0ke8VrxSJCGZvA==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::dfsNtlpA0ke8VrxSJCGZvA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2609\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2609\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=IntellimirrorGroup-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::6tlA3MT7l0OSC5sqe3jXBg==\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::6tlA3MT7l0OSC5sqe3jXBg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(110) = "DN=CN=PKICERTIFICATETEMPLATE-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2094) = "g\19\01&\14\00\00\00CN=pKICertificateTemplate-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002882\00uSNChanged\00\01\00\00\00\04\00\00\002882\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\1E\00\00\00pKICertificateTemplate-Display\00objectGUID\00\01\00\00\00\10\00\00\00\C24R\14\A1\CC\B3O\9C\89\CFgIWr\B1\00replPropertyMetaData\00\01\00\00\00\E0\02\00\00\01\00\00\00\00\00\00\00\0F\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECCB\0B\00\00\00\00\00\00B\0B\00\00\00\00\00\00\00iconPath\00\01\00\00\00\13\00\00\000,certtmpl.dll,-144\00contextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00adminPropertyPages\00\03\00\00\00(\00\00\003,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00classDisplayName\00\01\00\00\00\14\00\00\00Certificate Template\00adminContextMenu\00\01\00\00\00(\00\00\000,{11BDCE06-D55C-44e9-BC0B-8655F89E8CC5}\00attributeDisplayNames\00\02\00\00\00\17\00\00\00description,Description\00\07\00\00\00cn,Name\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1752\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1752\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2312\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2312\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2335\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2335\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=domainPolicy-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1675\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1675\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=94f238bb-831c-11d6-977b-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1598\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1598\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=msmq-Peek-Dead-Letter,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2258\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2258\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::z0eckhF3P064bCcFrLUGQw==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::z0eckhF3P064bCcFrLUGQw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=container-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::zGhqEl0M+0CS5JpoUdPvvQ==\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::zGhqEl0M+0CS5JpoUdPvvQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=default-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::164+pMnbwkKACcD34+iHuw==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::164+pMnbwkKACcD34+iHuw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::JUHF/LHdsUyEgPRM5Z3N/g==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::JUHF/LHdsUyEgPRM5Z3N/g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=trustedDomain-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2957\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2957\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=user-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(98) = "DN=CN=LOCAL SERVICE,CN=WELLKNOWN SECURITY PRINCIPALS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1790) = "g\19\01&\0E\00\00\00CN=Local Service,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\18\00\00\00foreignSecurityPrincipal\00cn\00\01\00\00\00\0D\00\00\00Local Service\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171917.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171917.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003363\00uSNChanged\00\01\00\00\00\04\00\00\003363\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\CC\02\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\80\02\12\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\18\00\FF\01\0F\00\01\02\00\00\00\00\00\05 \00\00\00$\02\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00T\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\00\00\01\00\00\01\00\00\00V\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B2\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\05\00(\000\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0A\00\00\00\00\00\14\00\00\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00B/\BAY\A2y\D0\11\90 \00\C0O\C2\D3\CF\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\86\B8\B5wJ\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00\B3\95W\E4U\94\D1\11\AE\BD\00\00\F8\03g\C1\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\10\00\00\00\01\00\00\00T\01\8D\E4\F8\BC\D1\11\87\02\00\C0O\B9`P\01\01\00\00\00\00\00\05\0B\00\00\00\05\00(\00\00\01\00\00\01\00\00\00S\1Ar\AB/\1E\D0\11\98\19\00\AA\00@R\9B\01\01\00\00\00\00\00\01\00\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0D\00\00\00Local Service\00objectGUID\00\01\00\00\00\10\00\00\00\CC\8E\8C\80\D0\C8\EDL\B3\F2n\F7d\ABU\A2\00replPropertyMetaData\00\01\00\00\00\C0\01\00\00\01\00\00\00\00\00\00\00\09\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\01\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\02\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\19\01\02\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\01\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\92\00\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\03\00\00\00\01\00\00\00\15@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC#\0D\00\00\00\00\00\00#\0D\00\00\00\00\00\00\00objectSid\00\01\00\00\00\0C\00\00\00\01\01\00\00\00\00\00\05\13\00\00\00\00objectCategory\00\01\00\00\00T\00\00\00CN=Foreign-Security-Principal,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::ZrHlkSM7bUuCecciz35beA==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::ZrHlkSM7bUuCecciz35beA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=DS-Replication-Get-Changes-All,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2760\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2760\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Ke9go8yRDEC+JB+Z7td1Iw==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Ke9go8yRDEC+JB+Z7td1Iw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::ClpqkWPN90SICbfYSF4kqg==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::ClpqkWPN90SICbfYSF4kqg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2683\00"
+data(165) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2683\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=nTDSConnection-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::cq5aK1+eUEC1KOI4/hVi6A==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::cq5aK1+eUEC1KOI4/hVi6A==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=NTDS Site Settings,CN=Default-First-Site-Name,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2719\00"
+data(139) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2719\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3005\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3005\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=mSMQQueue-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(97) = "DN=CN=DOMAINDNS-DISPLAY,CN=816,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2029) = "g\19\01&\12\00\00\00CN=domainDNS-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\11\00\00\00domainDNS-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002053\00uSNChanged\00\01\00\00\00\04\00\00\002053\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\11\00\00\00domainDNS-Display\00objectGUID\00\01\00\00\00\10\00\00\00\810-\F8&\97\0AH\B0p\0A\A0\22\91-\CA\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\05\08\00\00\00\00\00\00\05\08\00\00\00\00\00\00\00adminPropertyPages\00\05\00\00\00(\00\00\006,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\005,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\004,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe648c-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121ef-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\08\00\00\00Dom\C3\ADnio\00adminContextMenu\00\02\00\00\00(\00\00\002,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00(\00\00\001,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00attributeDisplayNames\00\02\00\00\00\17\00\00\00description,Descri\C3\A7\C3\A3o\00\07\00\00\00dc,Nome\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(45) = "DN=@INDEX:NAME:LICENSINGSITESETTINGS-DISPLAY\00"
+data(2831) = "g\19\01&\02\00\00\00@INDEX:NAME:LICENSINGSITESETTINGS-DISPLAY\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\19\00\00\00i\00\00\00CN=licensingSiteSettings-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=412,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=804,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=40D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=816,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=411,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2870\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2870\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2793\00"
+data(166) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2793\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3353\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3353\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=Authenticated Users,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(95) = "DN=CN=DEFAULT-DISPLAY,CN=41F,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(3124) = "g\19\01&\13\00\00\00CN=default-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\0F\00\00\00default-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003050\00uSNChanged\00\01\00\00\00\04\00\00\003050\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\0F\00\00\00default-Display\00objectGUID\00\01\00\00\00\10\00\00\00\EA\AE[\B8~R\B1O\8ETE\BFA*\CD\B8\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\003\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\97\06\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EA\0B\00\00\00\00\00\00\EA\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{f2c3faae-c8ac-11d0-bcdb-00c04fd8d5b6}\00adminContextMenu\00\01\00\00\00(\00\00\000,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\02\00\00\00\16\00\00\00description,A\C3\A7\C4\B1klama\00\07\00\00\00cn,Ad\C4\B1\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00extraColumns\00\1B\00\00\001\00\00\00msds-PhoneticDepartment,Fonetik B\C3\B6l\C3\BCm\C3\BC,0,100,0\005\00\00\00msds-PhoneticCompanyName,Fonetik \C5\9Eirket Ad\C4\B1,0,100,0\00-\00\00\00msds-PhoneticLastName,Fonetik Soyad\C4\B1,0,100,0\00)\00\00\00msds-PhoneticFirstName,Fonetik Ad,0,100,0\005\00\00\00msds-PhoneticDisplayName,Fonetik G\C3\B6r\C3\BCnen Ad,0,100,0\00\1D\00\00\00postalCode,Posta Kodu,0,100,0\001\00\00\00textEncodedORAddress,X.400 E-Posta Adresi,0,130,0\007\00\00\00userPrincipalName,Kullan\C4\B1c\C4\B1 oturum a\C3\A7ma ad\C4\B1,0,200,0\00\1A\00\00\00title,\C4\B0\C5\9F Unvan\C4\B1,0,100,0\00\22\00\00\00targetAddress,Hedef Adresi,0,100,0\00\10\00\00\00st,durum,0,100,0\00+\00\00\00physicalDeliveryOfficeName,\C4\B0\C5\9Fyeri,0,100,0\00 \00\00\00whenChanged,De\C4\9Fi\C5\9Ftirme,0,130,0\00\12\00\00\00sn,Soyad\C4\B1,0,100,0\001\00\00\00msExchIMMetaPhysicalURL,Anl\C4\B1k \C4\B0leti URL,0,140,0\006\00\00\00msExchIMPhysicalURL,Anl\C4\B1k \C4\B0leti Ana Sunucusu,0,170,0\00\19\00\00\00givenName,\C4\B0lk Ad,0,100,0\00,\00\00\00homeMDB,Exchange Posta Kutusu Deposu,0,100,0\00)\00\00\00mailNickname,Exchange Di\C4\9Fer Ad\C4\B1,0,175,0\00\1B\00\00\00mail,E-Posta Adresi,0,100,0\00=\00\00\00sAMAccountName,Windows 2000 \C3\96ncesi Oturum A\C3\A7ma Ad\C4\B1,0,120,0\00 \00\00\00displayName,G\C3\B6r\C3\BCnen Ad,0,100,0\00\1A\00\00\00department,B\C3\B6l\C3\BCm,0,150,0\00\0E\00\00\00c,\C3\9Clke,0,-1,0\00\17\00\00\00company,\C5\9Eirket,0,150,0\00\10\00\00\00l,\C5\9Eehir,0,150,0\00%\00\00\00telephoneNumber,\C4\B0\C5\9F Telefonu,0,100,0\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50d30563-9911-11d1-b9af-00c04fd8d5b0}\00"
+}
+{
+key(100) = "DN=CN=MSMQSETTINGS-DISPLAY,CN=407,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1766) = "g\19\01&\11\00\00\00CN=mSMQSettings-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00mSMQSettings-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002031\00uSNChanged\00\01\00\00\00\04\00\00\002031\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00mSMQSettings-Display\00objectGUID\00\01\00\00\00\10\00\00\00\DC\C3F;\9Bo\A5C\928BR\B4\D8\84*\00replPropertyMetaData\00\01\00\00\00P\02\00\00\01\00\00\00\00\00\00\00\0C\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\EF\07\00\00\00\00\00\00\EF\07\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-255\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{d251b000-d46e-11d1-8091-00a024c48131}\00classDisplayName\00\01\00\00\00\12\00\00\00MSMQ-Einstellungen\00adminContextMenu\00\01\00\00\00(\00\00\001,{d251b000-d46e-11d1-8091-00a024c48131}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1704\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1704\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=2a858903-5696-4364-b4e5-4cac027ca7a6,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:1627\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:1627\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=Allowed-To-Authenticate,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::dzB+kF3ZaEGdQqJ18QvVWw==\00"
+data(181) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::dzB+kF3ZaEGdQqJ18QvVWw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(16) = "DN=@REPLCHANGED\00"
+data(68) = "g\19\01&\02\00\00\00@REPLCHANGED\00uSNHighest\00\01\00\00\00\04\00\00\003392\00uSNUrgent\00\01\00\00\00\04\00\00\003380\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::GIfYzY8ChU+qQUColYbueA==\00"
+data(176) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::GIfYzY8ChU+qQUColYbueA==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00X\00\00\00CN=Network,CN=WellKnown Security Principals,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(98) = "DN=CN=PRINTQUEUE-DISPLAY,CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2934) = "g\19\01&\13\00\00\00CN=printQueue-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\12\00\00\00printQueue-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002732\00uSNChanged\00\01\00\00\00\04\00\00\002732\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\12\00\00\00printQueue-Display\00objectGUID\00\01\00\00\00\10\00\00\00Ka\19~W\F7RF\A6\DDx\0F\12\19\E1\DC\00replPropertyMetaData\00\01\00\00\00\B0\02\00\00\01\00\00\00\00\00\00\00\0E\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AC\0A\00\00\00\00\00\00\AC\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6dfe6493-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f5-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\09\00\00\00Stampante\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\1B\00\00\00\1E\00\00\00versionNumber,Versione oggetto\00\18\00\00\00url,Indirizzo pagina Web\00\16\00\00\00serverName,Nome server\00-\00\00\00printStaplingSupported,Supporta la graffatura\00 \00\00\00printShareName,Nome condivisione\00$\00\00\00printPagesPerMinute,Pagine al minuto\00\1E\00\00\00printRateUnit,Unit\C3\A0 velocit\C3\A0\00\13\00\00\00printRate,Velocit\C3\A0\00\1C\00\00\00printOwner,Nome proprietario\00\1E\00\00\00printMemory,Memoria installata\00,\00\00\00printMediaSupported,Tipi di carta supportati\00!\00\00\00printMediaReady,Carta disponibile\00/\00\00\00printMaxResolutionSupported,Risoluzione massima\00\22\00\00\00printLanguage,Linguaggio stampante\00\10\00\00\00printerName,Nome\004\00\00\00printDuplexSupported,Supporta la stampa fronte-retro\00&\00\00\00printColor,Supporta la stampa a colori\00'\00\00\00printCollate,Supporta la fascicolazione\00\1F\00\00\00printBinNames,Cassetti di input\00\0E\00\00\00portName,Porta\00\12\00\00\00location,Posizione\00\12\00\00\00driverName,Modello\00\14\00\00\00description,Commento\00\14\00\00\00contactName,Contatto\00\18\00\00\00assetNumber,Numero asset\00\11\00\00\00uNCName,Nome rete\00\1A\00\00\00cn,Nome servizio directory\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(48) = "DN=@INDEX:DISPLAYNAME:REMOTE ACCESS INFORMATION\00"
+data(171) = "g\19\01&\02\00\00\00@INDEX:DISPLAYNAME:REMOTE ACCESS INFORMATION\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00R\00\00\00CN=RAS-Information,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=436A1A4B-F41A-46E6-AC86-427720EF29F3,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=436a1a4b-f41a-46e6-ac86-427720ef29f3,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\00436a1a4b-f41a-46e6-ac86-427720ef29f3\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001694\00uSNChanged\00\01\00\00\00\04\00\00\001694\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00$\00\00\00436a1a4b-f41a-46e6-ac86-427720ef29f3\00objectGUID\00\01\00\00\00\10\00\00\00\CA\15\A8\96\C8\A9\83H\99\80'\1D\AD\C96\B4\00replPropertyMetaData\00\01\00\00\00\90\01\00\00\01\00\00\00\00\00\00\00\08\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\9E\06\00\00\00\00\00\00\9E\06\00\00\00\00\00\00\00objectCategory\00\01\00\00\00C\00\00\00CN=Container,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2712\00"
+data(162) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2712\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=queryPolicy-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2635\00"
+data(169) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2635\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2558\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2558\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1998\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1998\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2361\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2361\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=rpcContainer-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2284\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2284\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=printQueue-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::Fu8wWH5ZpEm7D0ycnHADdQ==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::Fu8wWH5ZpEm7D0ycnHADdQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=inetOrgPerson-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::qwOqF13ZpUeEkfDgoBA0Mg==\00"
+data(183) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::qwOqF13ZpUeEkfDgoBA0Mg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00_\00\00\00CN=nTFRSMember-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(91) = "DN=@INDEX:@IDXONE:CN=415,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(5767) = "g\19\01&\02\00\00\00@INDEX:@IDXONE:CN=415,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\007\00\00\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=nTDSDSA-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=domainPolicy-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=nTDSSiteSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=nTDSSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=siteLink-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=volume-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=nTDSConnection-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=rpcContainer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=trustedDomain-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00\5C\00\00\00CN=computer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=mSMQMigratedUser-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=printQueue-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=organizationalUnit-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=container-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=site-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=subnet-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00X\00\00\00CN=user-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=msMQ-Custom-Recipient-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=mSMQSiteLink-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=interSiteTransport-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=serversContainer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=msCOM-PartitionSet-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00o\00\00\00CN=interSiteTransportContainer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=nTDSService-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=localPolicy-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=default-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00i\00\00\00CN=licensingSiteSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00j\00\00\00CN=pKICertificateTemplate-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Z\00\00\00CN=server-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=siteLinkBridge-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=domainDNS-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00j\00\00\00CN=mSMQEnterpriseSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=inetOrgPerson-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00[\00\00\00CN=contact-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=subnetContainer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=nTFRSReplicaSet-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00a\00\00\00CN=nTFRSSettings-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=nTFRSMember-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00`\00\00\00CN=lostAndFound-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00d\00\00\00CN=IntellimirrorSCP-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=DS-UI-Default-Settings,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=IntellimirrorGroup-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=nTFRSSubscriber-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00e\00\00\00CN=mSMQConfiguration-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00]\00\00\00CN=mSMQQueue-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00_\00\00\00CN=queryPolicy-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00Y\00\00\00CN=group-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00^\00\00\00CN=msMQ-Group-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00b\00\00\00CN=sitesContainer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00c\00\00\00CN=msCOM-Partition-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::PNFX8nps8UaHikZ1+W0Cbw==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::PNFX8nps8UaHikZ1+W0Cbw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(24) = "DN=@INDEX:NAME:ADD-GUID\00"
+data(140) = "g\19\01&\02\00\00\00@INDEX:NAME:ADD-GUID\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00K\00\00\00CN=Add-GUID,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::dYQIogRQmkCttfyMGg1uug==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::dYQIogRQmkCttfyMGg1uug==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=interSiteTransport-Display,CN=401,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::59eE75I6bUKsLOJ2wf+q6g==\00"
+data(196) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::59eE75I6bUKsLOJ2wf+q6g==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00l\00\00\00CN=foreignSecurityPrincipal-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2822\00"
+data(167) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2822\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00d\00\00\00CN=serversContainer-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2745\00"
+data(159) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2745\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00\5C\00\00\00CN=siteLink-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(31) = "DN=@INDEX:OBJECTCLASS:SITELINK\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:OBJECTCLASS:SITELINK\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00i\00\00\00CN=DEFAULTIPSITELINK,CN=IP,CN=Inter-Site Transports,CN=Sites,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2668\00"
+data(156) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2668\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=41D,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(35) = "DN=@INDEX:NAME:PUBLIC KEY SERVICES\00"
+data(155) = "g\19\01&\02\00\00\00@INDEX:NAME:PUBLIC KEY SERVICES\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00O\00\00\00CN=Public Key Services,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=SITELINKBRIDGE-DISPLAY,CN=407,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1699) = "g\19\01&\10\00\00\00CN=siteLinkBridge-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\16\00\00\00siteLinkBridge-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002018\00uSNChanged\00\01\00\00\00\04\00\00\002018\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00siteLinkBridge-Display\00objectGUID\00\01\00\00\00\10\00\00\00a*\D7\B6\ADAmE\87&R?\CDf\FF~\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\E2\07\00\00\00\00\00\00\E2\07\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{50d30562-9911-11d1-b9af-00c04fd8d5b0}\00classDisplayName\00\01\00\00\00\1C\00\00\00Standortverkn\C3\BCpfungsbr\C3\BCcke\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:3031\00"
+data(160) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:3031\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00]\00\00\00CN=domainDNS-Display,CN=41F,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2394\00"
+data(177) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2394\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00n\00\00\00CN=serviceAdministrationPoint-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(38) = "DN=@INDEX:NAME:CERTIFICATE-ENROLLMENT\00"
+data(168) = "g\19\01&\02\00\00\00@INDEX:NAME:CERTIFICATE-ENROLLMENT\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=Certificate-Enrollment,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::ed4hxWu9sE6P3W6IAtob3w==\00"
+data(199) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::ed4hxWu9sE6P3W6IAtob3w==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00o\00\00\00CN=interSiteTransportContainer-Display,CN=415,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::2/fzE+8TY0aZWd/aLycrkg==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::2/fzE+8TY0aZWd/aLycrkg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=organizationalUnit-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(104) = "DN=CN=INTELLIMIRRORSCP-DISPLAY,CN=419,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1705) = "g\19\01&\10\00\00\00CN=IntellimirrorSCP-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171914.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171914.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002330\00uSNChanged\00\01\00\00\00\04\00\00\002330\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\18\00\00\00IntellimirrorSCP-Display\00objectGUID\00\01\00\00\00\10\00\00\00\1C\A9\01\B8\9C\FB\ABF\A6u/\89\BF\05*7\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\01\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\02\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\19\01\02\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\01\00\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\002\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\003\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00b\02\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\03\00\00\00\01\00\00\00\12@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1A\09\00\00\00\00\00\00\1A\09\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4e40f770-369c-11d0-8922-00a024ab2dbb}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00shellPropertyPages\00\01\00\00\00(\00\00\001,{AC409538-741C-11d1-BBE6-0060081692B3}\00classDisplayName\00\01\00\00\00\1A\00\00\00\D0\A1\D0\BB\D1\83\D0\B6\D0\B1\D0\B0 IntelliMirror\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(96) = "DN=CN=COMPUTER-DISPLAY,CN=410,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2695) = "g\19\01&\15\00\00\00CN=computer-Display,CN=410,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\10\00\00\00computer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002731\00uSNChanged\00\01\00\00\00\04\00\00\002731\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\10\00\00\00computer-Display\00objectGUID\00\01\00\00\00\10\00\00\00vL0<\DE:GD\A6\15x\EB;\FA\8DK\00replPropertyMetaData\00\01\00\00\00\10\03\00\00\01\00\00\00\00\00\00\00\10\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\003\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00&\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00,\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\AB\0A\00\00\00\00\00\00\AB\0A\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\09\00\00\00)\00\00\0012,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00)\00\00\0011,{c7499700-f96b-11d2-ac78-0008c7726cf7}\00)\00\00\0010,{0F65B1BF-740F-11d1-BBE6-0060081692B3}\00(\00\00\007,{B52C1E50-1DD2-11D1-BC43-00C04FC31FD3}\00(\00\00\006,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\005,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\004,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{77597368-7b15-11d0-a0c2-080036af3f03}\00(\00\00\001,{6dfe6492-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f4-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\08\00\00\00Computer\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\07\00\00\005\00\00\00MSDS-PhoneticDisplayName,Nome visualizzato (fonetico)\008\00\00\00samAccountName,Nome computer (precedente a Windows 2000)\001\00\00\00operatingSystemVersion,Versione sistema operativo\00!\00\00\00operatingSystem,Sistema operativo\00\14\00\00\00managedBy,Gestito da\00\17\00\00\00description,Descrizione\00\07\00\00\00cn,Nome\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00createWizardExt\00\01\00\00\00(\00\00\001,{D6D8C25A-4E83-11d2-8424-00C04FA372D4}\00"
+}
+{
+key(40) = "DN=@INDEX:NAME:DNS-HOST-NAME-ATTRIBUTES\00"
+data(172) = "g\19\01&\02\00\00\00@INDEX:NAME:DNS-HOST-NAME-ATTRIBUTES\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=DNS-Host-Name-Attributes,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(100) = "DN=CN=MSMQSITELINK-DISPLAY,CN=413,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1886) = "g\19\01&\12\00\00\00CN=mSMQSiteLink-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\14\00\00\00mSMQSiteLink-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002590\00uSNChanged\00\01\00\00\00\04\00\00\002590\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\14\00\00\00mSMQSiteLink-Display\00objectGUID\00\01\00\00\00\10\00\00\00\11\7F\A9j\A8\1AVM\AB\B4\FAMq\C5!\9C\00replPropertyMetaData\00\01\00\00\00\80\02\00\00\01\00\00\00\00\00\00\00\0D\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\DB\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\F2\01\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\0A\00\00\00\00\00\00\1E\0A\00\00\00\00\00\00\00iconPath\00\01\00\00\00\11\00\00\000,mqsnap.dll,-254\00creationWizard\00\01\00\00\00&\00\00\00{87b31390-d46d-11d1-8091-00a024c48131}\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{87b31390-d46d-11d1-8091-00a024c48131}\00classDisplayName\00\01\00\00\00\1C\00\00\00Koppeling van MSMQ-routering\00adminContextMenu\00\01\00\00\00(\00\00\001,{87b31390-d46d-11d1-8091-00a024c48131}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::5u7b+WKVn0CClVvqBljtBQ==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::5u7b+WKVn0CClVvqBljtBQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=lostAndFound-Display,CN=405,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::uQWSUJELBUG9+cD7IEVjLw==\00"
+data(190) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::uQWSUJELBUG9+cD7IEVjLw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00f\00\00\00CN=nTFRSSubscriptions-Display,CN=413,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=SITESCONTAINER-DISPLAY,CN=409,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1731) = "g\19\01&\10\00\00\00CN=sitesContainer-Display,CN=409,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\16\00\00\00sitesContainer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002875\00uSNChanged\00\01\00\00\00\04\00\00\002875\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00sitesContainer-Display\00objectGUID\00\01\00\00\00\10\00\00\00\A9\A8\0D'\EA\E68K\B8\8B\8F\D0\87\FF\B9\DC\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\002\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00b\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00f\02\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC;\0B\00\00\00\00\00\00;\0B\00\00\00\00\00\00\00adminPropertyPages\00\04\00\00\00(\00\00\004,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\003,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\002,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\001,{6384e23e-736d-11d1-bd0d-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0F\00\00\00Sites Container\00adminContextMenu\00\02\00\00\00(\00\00\002,{6BA3F852-23C6-11D1-B91F-00A0C9A06D2D}\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1830\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1830\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=contact-Display,CN=40C,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(96) = "DN=CN=COMPUTER-DISPLAY,CN=406,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(2677) = "g\19\01&\15\00\00\00CN=computer-Display,CN=406,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\10\00\00\00computer-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171916.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171916.0Z\00uSNCreated\00\01\00\00\00\04\00\00\003165\00uSNChanged\00\01\00\00\00\04\00\00\003165\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\10\00\00\00computer-Display\00objectGUID\00\01\00\00\00\10\00\00\00\B2\C6\0E-lm\1EO\BC\16\08\A2\98\0F\CC\A5\00replPropertyMetaData\00\01\00\00\00\10\03\00\00\01\00\00\00\00\00\00\00\10\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\01\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\02\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\19\01\02\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\01\00\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\002\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\003\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00b\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00f\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00&\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00,\03\09\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\03\00\00\00\01\00\00\00\14@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC]\0C\00\00\00\00\00\00]\0C\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\09\00\00\00)\00\00\0012,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00)\00\00\0011,{c7499700-f96b-11d2-ac78-0008c7726cf7}\00)\00\00\0010,{0F65B1BF-740F-11d1-BBE6-0060081692B3}\00(\00\00\007,{B52C1E50-1DD2-11D1-BC43-00C04FC31FD3}\00(\00\00\006,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\005,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\004,{6dfe648b-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{77597368-7b15-11d0-a0c2-080036af3f03}\00(\00\00\001,{6dfe6492-a212-11d0-bcd5-00c04fd8d5b6}\00shellPropertyPages\00\02\00\00\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00(\00\00\001,{f5d121f4-c8ac-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\08\00\00\00Computer\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00\07\00\00\00+\00\00\00MSDS-PhoneticDisplayName,Fonetisk vist navn\00/\00\00\00samAccountName,Computernavn (f\C3\B8r Windows 2000)\00/\00\00\00operatingSystemVersion,Operativsystem - version\00\1E\00\00\00operatingSystem,Operativsystem\00\1A\00\00\00managedBy,Administreret af\00\17\00\00\00description,Beskrivelse\00\07\00\00\00cn,Navn\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00createWizardExt\00\01\00\00\00(\00\00\001,{D6D8C25A-4E83-11d2-8424-00C04FA372D4}\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1753\00"
+data(179) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1753\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00p\00\00\00CN=Optional Features,CN=Directory Service,CN=Windows NT,CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2313\00"
+data(161) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2313\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00^\00\00\00CN=msMQ-Group-Display,CN=408,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1676\00"
+data(182) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1676\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00s\00\00\00CN=94f238bc-831c-11d6-977b-00c04f613221,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2236\00"
+data(157) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2236\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Z\00\00\00CN=subnet-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:1599\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:1599\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=msmq-Receive-computer-Journal,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::3P0E4QguNkGqoEcGlSz/lg==\00"
+data(184) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::3P0E4QguNkGqoEcGlSz/lg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSiteLink-Display,CN=407,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCREATED:2159\00"
+data(139) = "g\19\01&\02\00\00\00@INDEX:USNCREATED:2159\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00H\00\00\00CN=C04,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::gmc62kt4kkGfQhsw0+kPpw==\00"
+data(185) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::gmc62kt4kkGfQhsw0+kPpw==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00a\00\00\00CN=nTFRSSettings-Display,CN=40B,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::g7Nv0uzBPkyv4EZLHYoBvQ==\00"
+data(186) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::g7Nv0uzBPkyv4EZLHYoBvQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00b\00\00\00CN=DS-UI-Default-Settings,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(102) = "DN=CN=DS-UI-DEFAULT-SETTINGS,CN=C0A,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1680) = "g\19\01&\10\00\00\00CN=DS-UI-Default-Settings,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\0C\00\00\00dSUISettings\00cn\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171915.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171915.0Z\00uSNCreated\00\01\00\00\00\04\00\00\002608\00uSNChanged\00\01\00\00\00\04\00\00\002608\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\16\00\00\00DS-UI-Default-Settings\00objectGUID\00\01\00\00\00\10\00\00\00\A4lc\13\87\E3\E6B\B7\CF\D3\F5=\A0G+\00replPropertyMetaData\00\01\00\00\00 \02\00\00\01\00\00\00\00\00\00\00\0B\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\01\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\02\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\19\01\02\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\01\00\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00?\05\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\99\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\A7\06\09\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\03\00\00\00\01\00\00\00\13@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC0\0A\00\00\00\00\00\000\0A\00\00\00\00\00\00\00objectCategory\00\01\00\00\00H\00\00\00CN=DS-UI-Settings,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00dSUIAdminNotification\00\02\00\00\00(\00\00\002,{a00e1768-4a9b-4d97-afc6-99d329f605f2}\00(\00\00\001,{E62F8206-B71C-11D1-808D-00A024C48131}\00msDS-Non-Security-Group-Extra-Classes\00\02\00\00\00\13\00\00\00mSMQCustomRecipient\00\09\00\00\00mSMQQueue\00msDS-FilterContainers\00\05\00\00\00\08\00\00\00dns-Zone\00\09\00\00\00Container\00\0E\00\00\00Lost-And-Found\00\0E\00\00\00Builtin-Domain\00\13\00\00\00Organizational-Unit\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::0CKadNQiXEiBpiTthp9NEg==\00"
+data(197) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::0CKadNQiXEiBpiTthp9NEg==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00m\00\00\00CN=remoteStorageServicePoint-Display,CN=C0A,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(101) = "DN=CN=INETORGPERSON-DISPLAY,CN=416,CN=DISPLAYSPECIFIERS,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(4426) = "g\19\01&\15\00\00\00CN=inetOrgPerson-Display,CN=416,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\10\00\00\00displaySpecifier\00cn\00\01\00\00\00\15\00\00\00inetOrgPerson-Display\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001822\00uSNChanged\00\01\00\00\00\04\00\00\001822\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\00\1A$\00\BD\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00name\00\01\00\00\00\15\00\00\00inetOrgPerson-Display\00objectGUID\00\01\00\00\00\10\00\00\00\10\DA\E2\DD+\E0oA\8F\8F\D6\AA:\F8%\97\00replPropertyMetaData\00\01\00\00\00\10\03\00\00\01\00\00\00\00\00\00\00\10\00\00\00\00\00\00\00\00\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\01\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\02\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\A9\00\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\19\01\02\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\01\00\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\F3\01\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\002\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\003\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00b\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00f\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\EC\02\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\0E\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00&\03\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\9A\06\09\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\03\00\00\00\01\00\00\00\11@\00\04\03\00\00\00fj\FF@\80\1D\E7I\97!3N\03s\ECC\1E\07\00\00\00\00\00\00\1E\07\00\00\00\00\00\00\00contextMenu\00\01\00\00\00(\00\00\000,{62AE1F9A-126A-11D0-A14B-0800361B1103}\00adminPropertyPages\00\09\00\00\00)\00\00\0010,{C7436F12-A27F-4cab-AACA-2BD27ED1B773}\00(\00\00\001,{6dfe6485-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\003,{B52C1E50-1DD2-11D1-BC43-00C04FC31FD3}\00(\00\00\004,{FD57D295-4FD9-11D1-854E-00C04FC31FD3}\00(\00\00\005,{6dfe6488-a212-11d0-bcd5-00c04fd8d5b6}\00(\00\00\006,{4E40F770-369C-11d0-8922-00A024AB2DBB}\00(\00\00\007,{8c5b1b50-d46e-11d1-8091-00a024c48131}\00(\00\00\008,{0910dd01-df8c-11d1-ae27-00c04fa35813}\00(\00\00\009,{FA3E1D55-16DF-446D-872E-BD04D4F39C93}\00shellPropertyPages\00\02\00\00\00(\00\00\001,{f5d121ed-c8ac-11d0-bcdb-00c04fd8d5b6}\00(\00\00\002,{dde2c5e9-c8ae-11d0-bcdb-00c04fd8d5b6}\00classDisplayName\00\01\00\00\00\0D\00\00\00InetOrgPerson\00adminContextMenu\00\01\00\00\00(\00\00\001,{08eb4fa6-6ffd-11d1-b0e0-00c04fd8dca6}\00attributeDisplayNames\00<\00\00\00\14\00\00\00assistant,Assistente\00\07\00\00\00cn,Nome\00\17\00\00\00c,Abrevia\C3\A7\C3\A3o de Pa\C3\ADs\00\08\00\00\00co,Pa\C3\ADs\00\13\00\00\00comment,Coment\C3\A1rio\00\0F\00\00\00company,Empresa\00\17\00\00\00department,Departamento\00\17\00\00\00description,Descri\C3\A7\C3\A3o\00!\00\00\00directReports,Relat\C3\B3rios Diretos\00\1F\00\00\00distinguishedName,Nome Distinto\00\11\00\00\00division,Divis\C3\A3o\00*\00\00\00employeeID,Identifica\C3\A7\C3\A3o de Funcion\C3\A1rio\00\1C\00\00\00facsimileTelephoneNumber,Fax\00#\00\00\00generationQualifier,Sufixo Gerativo\00\17\00\00\00givenName,Primeiro Nome\00\1B\00\00\00homeDirectory,Pasta Inicial\00\19\00\00\00homeDrive,Unidade Inicial\00\1E\00\00\00homePhone,Telefone Residencial\00'\00\00\00homePostalAddress,Endere\C3\A7o Residencial\00\11\00\00\00initials,Iniciais\003\00\00\00internationalISDNNumber,ISDN Internacional (Outros)\00\13\00\00\00ipPhone,Telefone IP\00\08\00\00\00l,Cidade\00\0A\00\00\00mail,Email\00\0F\00\00\00manager,Gerente\00\12\00\00\00memberOf,Membro de\00\17\00\00\00middleName,Segundo Nome\00\0E\00\00\00mobile,Celular\00.\00\00\00mSDS-PhoneticDepartment,Departamento Fon\C3\A9tico\002\00\00\00mSDS-PhoneticCompanyName,Nome Fon\C3\A9tico da Empresa\007\00\00\00mSDS-PhoneticDisplayName,Nome para Exibi\C3\A7\C3\A3o Fon\C3\A9tico\00)\00\00\00mSDS-PhoneticLastName,Sobrenome Fon\C3\A9tico\00%\00\00\00mSDS-PhoneticFirstName,Nome Fon\C3\A9tico\00\10\00\00\00info,Anota\C3\A7\C3\B5es\00*\00\00\00otherFacsimileTelephoneNumber,Fax (Outros)\00,\00\00\00otherHomePhone,Telefone Residencial (Outros)\00!\00\00\00otherIpPhone,Telefone IP (Outros)\00\1B\00\00\00otherMailbox,Email (Outros)\00\1C\00\00\00otherMobile,Celular (Outros)\00\19\00\00\00otherPager,Pager (Outros)\00 \00\00\00otherTelephone,Telefone (Outros)\00\0B\00\00\00pager,Pager\00\15\00\00\00personalTitle,T\C3\ADtulo\00.\00\00\00physicalDeliveryOfficeName,Endere\C3\A7o comercial\00\1D\00\00\00postalCode,CEP/C\C3\B3digo Postal\00\1A\00\00\00postOfficeBox,Caixa Postal\001\00\00\00primaryInternationalISDNNumber,ISDN Internacional\00\18\00\00\00primaryTelexNumber,Telex\007\00\00\00samAccountName,Nome de Logon (anterior ao Windows 2000)\00\0C\00\00\00sn,Sobrenome\00\09\00\00\00st,Estado\00\17\00\00\00streetAddress,Endere\C3\A7o\00\18\00\00\00telephoneNumber,Telefone\00\1A\00\00\00telexNumber,Telex (Outros)\00\0B\00\00\00title,Cargo\00(\00\00\00url,Endere\C3\A7o da P\C3\A1gina da Web (Outros)\00 \00\00\00displayName,Nome para Exibi\C3\A7\C3\A3o\000\00\00\00userWorkstations,Esta\C3\A7\C3\B5es de Trabalho de Logon\00\1F\00\00\00userPrincipalName,Nome de Logon\00'\00\00\00wWWHomePage,Endere\C3\A7o da P\C3\A1gina da Web\00objectCategory\00\01\00\00\00K\00\00\00CN=Display-Specifier,CN=Schema,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00treatAsLeaf\00\01\00\00\00\04\00\00\00TRUE\00adminMultiselectPropertyPages\00\01\00\00\00(\00\00\001,{50D30564-9911-11D1-B9AF-00C04FD8D5B0}\00"
+}
+{
+key(36) = "DN=@INDEX:NAME:PERSONAL-INFORMATION\00"
+data(164) = "g\19\01&\02\00\00\00@INDEX:NAME:PERSONAL-INFORMATION\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00W\00\00\00CN=Personal-Information,CN=Extended-Rights,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2500\00"
+data(156) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2500\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00Y\00\00\00CN=group-Display,CN=404,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(47) = "DN=@INDEX:OBJECTGUID::7OPKRjVRwkaDSkYAps3ViQ==\00"
+data(144) = "g\19\01&\02\00\00\00@INDEX:OBJECTGUID::7OPKRjVRwkaDSkYAps3ViQ==\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\008\00\00\00CN=Services,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2423\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2423\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=mSMQSettings-Display,CN=40E,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2346\00"
+data(158) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2346\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00[\00\00\00CN=nTDSDSA-Display,CN=419,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(26) = "DN=@INDEX:USNCHANGED:2269\00"
+data(163) = "g\19\01&\02\00\00\00@INDEX:USNCHANGED:2269\00@IDXVERSION\00\01\00\00\00\01\00\00\002\00@IDX\00\01\00\00\00`\00\00\00CN=lostAndFound-Display,CN=414,CN=DisplaySpecifiers,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00"
+}
+{
+key(119) = "DN=CN=1BDF6366-C3DB-4D0B-B8CB-F99BA9BCE20F,CN=OPERATIONS,CN=FORESTUPDATES,CN=CONFIGURATION,DC=ALPHA13,DC=SAMBA,DC=CORP\00"
+data(1262) = "g\19\01&\0D\00\00\00CN=1bdf6366-c3db-4d0b-b8cb-f99ba9bce20f,CN=Operations,CN=ForestUpdates,CN=Configuration,DC=alpha13,DC=samba,DC=corp\00objectClass\00\02\00\00\00\03\00\00\00top\00\09\00\00\00container\00cn\00\01\00\00\00$\00\00\001bdf6366-c3db-4d0b-b8cb-f99ba9bce20f\00instanceType\00\01\00\00\00\01\00\00\004\00whenCreated\00\01\00\00\00\11\00\00\0020110608171913.0Z\00whenChanged\00\01\00\00\00\11\00\00\0020110608171913.0Z\00uSNCreated\00\01\00\00\00\04\00\00\001696\00uSNChanged\00\01\00\00\00\04\00\00\001696\00showInAdvancedViewOnly\00\01\00\00\00\04\00\00\00TRUE\00nTSecurityDescriptor\00\01\00\00\00\E8\00\00\00\01\00\05\84\14\00\00\000\00\00\00\00\00\00\00L\00\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\07\02\00\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\01\02\00\00\04\00\9C\00\05\00\00\00\00\00$\00\FF\01\0F\00\01\05\00\00\00\00\00\05\15\00\00\00\03\CF5\C1P\96rb\D3\FDl\ED\00\02\00\00\00\00\14\00\FF\01\0F\00\01\01\00\00\00\00\00\05\12\00\00\00\00\00\14\00\94\00\02\00\01\01\00\00\00\00\00\05\0B\00\00\00\00\12$\00\FF\01\0F\00\01\05\00\00